Recombinant Human KDM6A protein(1095-1258aa), His&Myc-tagged

Cat.No. : KDM6A-8124H
Product Overview : Recombinant Human KDM6A protein(O15550)(1095-1258aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 1095-1258aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 26.2 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : KWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEW
Gene Name KDM6A lysine (K)-specific demethylase 6A [ Homo sapiens ]
Official Symbol KDM6A
Synonyms KDM6A; lysine (K)-specific demethylase 6A; ubiquitously transcribed tetratricopeptide repeat, X chromosome , UTX; lysine-specific demethylase 6A; histone demethylase UTX; ubiquitously-transcribed TPR gene on the X chromosome; ubiquitously transcribed TPR protein on the X chromosome; ubiquitously-transcribed TPR protein on the X chromosome; ubiquitously transcribed tetratricopeptide repeat protein X-linked; ubiquitously transcribed X chromosome tetratricopeptide repeat protein; ubiquitously-transcribed X chromosome tetratricopeptide repeat protein; bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeat protein (UTX)); UTX; KABUK2; bA386N14.2; MGC141941; DKFZp686A03225;
Gene ID 7403
mRNA Refseq NM_021140
Protein Refseq NP_066963
MIM 300128
UniProt ID O15550

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KDM6A Products

Required fields are marked with *

My Review for All KDM6A Products

Required fields are marked with *

0
cart-icon