Recombinant Human KDM6A protein(1095-1258aa), His&Myc-tagged
Cat.No. : | KDM6A-8124H |
Product Overview : | Recombinant Human KDM6A protein(O15550)(1095-1258aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1095-1258aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEW |
Gene Name | KDM6A lysine (K)-specific demethylase 6A [ Homo sapiens ] |
Official Symbol | KDM6A |
Synonyms | KDM6A; lysine (K)-specific demethylase 6A; ubiquitously transcribed tetratricopeptide repeat, X chromosome , UTX; lysine-specific demethylase 6A; histone demethylase UTX; ubiquitously-transcribed TPR gene on the X chromosome; ubiquitously transcribed TPR protein on the X chromosome; ubiquitously-transcribed TPR protein on the X chromosome; ubiquitously transcribed tetratricopeptide repeat protein X-linked; ubiquitously transcribed X chromosome tetratricopeptide repeat protein; ubiquitously-transcribed X chromosome tetratricopeptide repeat protein; bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeat protein (UTX)); UTX; KABUK2; bA386N14.2; MGC141941; DKFZp686A03225; |
Gene ID | 7403 |
mRNA Refseq | NM_021140 |
Protein Refseq | NP_066963 |
MIM | 300128 |
UniProt ID | O15550 |
◆ Recombinant Proteins | ||
KDM6A-8124H | Recombinant Human KDM6A protein(1095-1258aa), His&Myc-tagged | +Inquiry |
Kdm6a-3683M | Recombinant Mouse Kdm6a Protein, Myc/DDK-tagged | +Inquiry |
KDM6A-84H | Active Recombinant Human KDM6A protein, FLAG-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDM6A-4991HCL | Recombinant Human KDM6A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDM6A Products
Required fields are marked with *
My Review for All KDM6A Products
Required fields are marked with *