| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
Met1-Val298 |
| Description : |
Ketohexokinase, also known as Hepatic fructokinase, is a member of the carbohydrate kinase PfkB family. It exits as a homodimer and most abundant in liver, kidney, gut, spleen and pancreas. Low levels also found in adrenal, muscle, brain and eye.This enzyme catalyzes conversion of fructose to fructose-1-phosphate. It is the first enzyme with a specialized pathway that catabolizes dietary fructose. Defects in KHK are the cause of fructosuria. |
| Form : |
Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,50nM KCl,10%Glycerol,pH7.4. |
| AA Sequence : |
MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAP GHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDL TQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDV AKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTF NASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIVVDHHHHHH |
| Endotoxin : |
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity : |
Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : |
Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Shipping : |
The product is shipped on dry ice/ice packs. |