Cat.No.:	KHK-493H
Product Overview:	Recombinant Human KHK(Met1-Val298) fused with His tag at C-terminal was expressed in HEK293.
Description:	Ketohexokinase, also known as Hepatic fructokinase, is a member of the carbohydrate kinase PfkB family. It exits as a homodimer and most abundant in liver, kidney, gut, spleen and pancreas. Low levels also found in adrenal, muscle, brain and eye.This enzyme catalyzes conversion of fructose to fructose-1-phosphate. It is the first enzyme with a specialized pathway that catabolizes dietary fructose. Defects in KHK are the cause of fructosuria.
Source:	HEK293
Species:	Human
Tag :	His
Form:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,50nM KCl,10%Glycerol,pH7.4.
Protein length:	Met1-Val298
AA Sequence:	MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAP GHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDL TQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDV AKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTF NASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIVVDHHHHHH
Endotoxin:	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Storage:	Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Shipping:	The product is shipped on dry ice/ice packs.

Gene Name:	KHK ketohexokinase (fructokinase) [ Homo sapiens ]
Official Symbol:	KHK
Synonyms:	KHK; ketohexokinase (fructokinase); ketohexokinase; hepatic fructokinase;
Gene ID:	3795
mRNA Refseq:	NM_000221
Protein Refseq:	NP_000212
MIM:	614058
UniProt ID:	P50053

Online Inquiry