Recombinant Human KHK protein, His-tagged
Cat.No. : | KHK-493H |
Product Overview : | Recombinant Human KHK(Met1-Val298) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Met1-Val298 |
Description : | Ketohexokinase, also known as Hepatic fructokinase, is a member of the carbohydrate kinase PfkB family. It exits as a homodimer and most abundant in liver, kidney, gut, spleen and pancreas. Low levels also found in adrenal, muscle, brain and eye.This enzyme catalyzes conversion of fructose to fructose-1-phosphate. It is the first enzyme with a specialized pathway that catabolizes dietary fructose. Defects in KHK are the cause of fructosuria. |
Form : | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,50nM KCl,10%Glycerol,pH7.4. |
AA Sequence : | MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAP GHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDL TQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDV AKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTF NASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIVVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Shipping : | The product is shipped on dry ice/ice packs. |
Gene Name | KHK ketohexokinase (fructokinase) [ Homo sapiens ] |
Official Symbol | KHK |
Synonyms | KHK; ketohexokinase (fructokinase); ketohexokinase; hepatic fructokinase; |
Gene ID | 3795 |
mRNA Refseq | NM_000221 |
Protein Refseq | NP_000212 |
MIM | 614058 |
UniProt ID | P50053 |
◆ Recombinant Proteins | ||
KHK-29893TH | Recombinant Human KHK | +Inquiry |
KHK-747Z | Recombinant Zebrafish KHK | +Inquiry |
KHK-491H | Recombinant Human Ketohexokinase | +Inquiry |
KHK-3586HFL | Recombinant Full Length Human KHK, Flag-tagged | +Inquiry |
KHK-450H | Active Recombinant Human KHK, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KHK-4985HCL | Recombinant Human KHK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KHK Products
Required fields are marked with *
My Review for All KHK Products
Required fields are marked with *
0
Inquiry Basket