Recombinant Human KIF20B protein, GST-tagged
| Cat.No. : | KIF20B-301305H |
| Product Overview : | Recombinant Human KIF20B (477-580 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met477-Ile580 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MQKVCVPDTLNSSQEKLFGPVKSSQDVSLDSNSNSKILNVKRATISWENSLEDLMEDEDLVEELENAEETQNVETKLLDEDLDKTLEENKAFISHEEKRKLLDLI |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | KIF20B kinesin family member 20B [ Homo sapiens (human) ] |
| Official Symbol | KIF20B |
| Synonyms | CT90; MPP1; KRMP1; MPP-1; MPHOSPH1 |
| Gene ID | 9585 |
| mRNA Refseq | NM_001284259 |
| Protein Refseq | NP_001271188 |
| MIM | 605498 |
| UniProt ID | Q96Q89 |
| ◆ Recombinant Proteins | ||
| KIF20B-5496H | Recombinant Human KIF20B Protein, GST-tagged | +Inquiry |
| KIF20B-8631M | Recombinant Mouse KIF20B Protein | +Inquiry |
| KIF20B-301305H | Recombinant Human KIF20B protein, GST-tagged | +Inquiry |
| KIF20B-4603H | Recombinant Human KIF20B protein, His-tagged | +Inquiry |
| KIF20B-4810M | Recombinant Mouse KIF20B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIF20B Products
Required fields are marked with *
My Review for All KIF20B Products
Required fields are marked with *
