Recombinant Human KIR2DL1 Protein, C-His-tagged

Cat.No. : KIR2DL1-080H
Product Overview : Recombinant Human KIR2DL1 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : NKAT (NK-associated transcripts) gene products, known as killer immunoglobulin-like receptors or KIRs, downregulate the cytotoxicity of NK cells upon recognition of specific class I major histocompatibility complex (MHC) molecules on target cells. This family of receptors is characterized by an extracellular region with two to three immunoglobulin-superfamily domains and a cytoplasmic domain with an antigen receptor activation motif (ARAM). KIRs and other inhibitory receptors also possess a common cytoplasmic sequence (I/VxYxxL/V) known as an ITIM (immunoreceptor tyrosine-based inhibitory motif). The human inhibitory natural killer cell immunoglobulin-like receptor 2DL1, also designated KIR2DL1, CL-42, NKAT1, P58.1 or CD158a long form, is a 348 amino acid type I transmembrane protein. KIR2DL1 can bind human leukocyte antigen-C (HLA-C) via both polar and hydrophobic interactions through Met 44 in a binding pocket that coordinates Lys 80 of HLA-C.
Molecular Mass : ~25 kDa
AA Sequence : HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name KIR2DL1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1 [ Homo sapiens (human) ]
Official Symbol KIR2DL1
Synonyms KIR2DL1; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1; killer cell immunoglobulin-like receptor 2DL1; 47.11; CD158A; cl 42; nkat1; p58.1; NKAT-1; killer Ig receptor; p58 NK receptor CL-42/47.11; MHC class I NK cell receptor; killer inhibitory receptor 2-2-1; CD158 antigen-like family member A; natural killer-associated transcript 1; p58 NK cell inhibitory receptor NKR-K6; p58.1 MHC class-I-specific NK receptor; p58 killer cell inhibitory receptor KIR-K64; p58 natural killer cell receptor clones CL-42/47.11; NKAT; NKAT1; KIR221; KIR-K64;
Gene ID 3802
mRNA Refseq NM_014218
Protein Refseq NP_055033
MIM 604936
UniProt ID P43626

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIR2DL1 Products

Required fields are marked with *

My Review for All KIR2DL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon