Recombinant Human KIR2DL1 Protein, C-His-tagged
Cat.No. : | KIR2DL1-080H |
Product Overview : | Recombinant Human KIR2DL1 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | NKAT (NK-associated transcripts) gene products, known as killer immunoglobulin-like receptors or KIRs, downregulate the cytotoxicity of NK cells upon recognition of specific class I major histocompatibility complex (MHC) molecules on target cells. This family of receptors is characterized by an extracellular region with two to three immunoglobulin-superfamily domains and a cytoplasmic domain with an antigen receptor activation motif (ARAM). KIRs and other inhibitory receptors also possess a common cytoplasmic sequence (I/VxYxxL/V) known as an ITIM (immunoreceptor tyrosine-based inhibitory motif). The human inhibitory natural killer cell immunoglobulin-like receptor 2DL1, also designated KIR2DL1, CL-42, NKAT1, P58.1 or CD158a long form, is a 348 amino acid type I transmembrane protein. KIR2DL1 can bind human leukocyte antigen-C (HLA-C) via both polar and hydrophobic interactions through Met 44 in a binding pocket that coordinates Lys 80 of HLA-C. |
Molecular Mass : | ~25 kDa |
AA Sequence : | HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | KIR2DL1 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1 [ Homo sapiens (human) ] |
Official Symbol | KIR2DL1 |
Synonyms | KIR2DL1; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1; killer cell immunoglobulin-like receptor 2DL1; 47.11; CD158A; cl 42; nkat1; p58.1; NKAT-1; killer Ig receptor; p58 NK receptor CL-42/47.11; MHC class I NK cell receptor; killer inhibitory receptor 2-2-1; CD158 antigen-like family member A; natural killer-associated transcript 1; p58 NK cell inhibitory receptor NKR-K6; p58.1 MHC class-I-specific NK receptor; p58 killer cell inhibitory receptor KIR-K64; p58 natural killer cell receptor clones CL-42/47.11; NKAT; NKAT1; KIR221; KIR-K64; |
Gene ID | 3802 |
mRNA Refseq | NM_014218 |
Protein Refseq | NP_055033 |
MIM | 604936 |
UniProt ID | P43626 |
◆ Recombinant Proteins | ||
KIR2DL1-496H | Recombinant Human KIR2DL1 protein, His-Avi-tagged | +Inquiry |
KIR2DL1-080H | Recombinant Human KIR2DL1 Protein, C-His-tagged | +Inquiry |
KIR2DL1-495H | Recombinant Human KIR2DL1 Protein, His-tagged | +Inquiry |
KIR2DL1-626HB | Recombinant Human KIR2DL1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
KIR2DL1-3336H | Recombinant Human KIR2DL1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR2DL1-1701HCL | Recombinant Human KIR2DL1 cell lysate | +Inquiry |
KIR2DL1-1657HCL | Recombinant Human KIR2DL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIR2DL1 Products
Required fields are marked with *
My Review for All KIR2DL1 Products
Required fields are marked with *
0
Inquiry Basket