Recombinant Human KLK8 Protein, His-tagged
Cat.No. : | KLK8-081H |
Product Overview : | Recombinant human KLK8 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 260 |
Description : | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in tandem in a gene cluster on chromosome 19. The encoded protein may be involved in proteolytic cascade in the skin and may serve as a biomarker for ovarian cancer. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. |
Form : | Lyophilized |
Molecular Mass : | 25.8 kDa |
AA Sequence : | MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | KLK8 kallikrein-related peptidase 8 [ Homo sapiens (human) ] |
Official Symbol | KLK8 |
Synonyms | KLK8; kallikrein-related peptidase 8; kallikrein 8 (neuropsin/ovasin) , PRSS19; kallikrein-8; HNP; neuropsin; ovasin; TADG14; hK8; neuropsin type 1; neuropsin type 2; serine protease 19; KLK8 protein type 1; KLK8 protein type 2; serine protease TADG-14; tumor-associated differentially expressed gene 14 protein; NP; NRPN; PRSS19; |
Gene ID | 11202 |
mRNA Refseq | NM_007196 |
Protein Refseq | NP_009127 |
MIM | 605644 |
UniProt ID | O60259 |
◆ Recombinant Proteins | ||
KLK8-462H | Recombinant Human KLK8 Protein, DDK-tagged | +Inquiry |
KLK8-3968H | Recombinant Human KLK8 Protein (Gln29-Gly260), N-His tagged | +Inquiry |
KLK8-4881M | Recombinant Mouse KLK8 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLK8-998H | Active Recombinant Human KLK8 Protein, His-tagged | +Inquiry |
KLK8-688H | Recombinant Human KLK8 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK8-1985HCL | Recombinant Human KLK8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLK8 Products
Required fields are marked with *
My Review for All KLK8 Products
Required fields are marked with *
0
Inquiry Basket