Recombinant Human KNG1 protein, T7/His-tagged

Cat.No. : KNG1-70H
Product Overview : Recombinant Full-length heavy chain domain (HMWK) of human KNG1 cDNA (19 – 380 aa, derived from BC060039) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATK TVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQ YDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRMTYSIVQTNCSKENFLFL TPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKL NAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKI YPTVNCQPLGMISLMK
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro KNG1 H chain mediated endothelial cell differentiation / migration activities regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for KNG1 H chain protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. May be used for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name KNG1 kininogen 1 [ Homo sapiens ]
Official Symbol KNG1
Synonyms KNG1; kininogen 1; BDK, kininogen , KNG; kininogen-1; alpha 2 thiol proteinase inhibitor; bradykinin; HMWK; fitzgerald factor; high molecular weight kininogen; alpha-2-thiol proteinase inhibitor; williams-Fitzgerald-Flaujeac factor; BDK; KNG;
Gene ID 3827
mRNA Refseq NM_000893
Protein Refseq NP_000884
MIM 612358
UniProt ID P01042
Chromosome Location 3q21-qter
Pathway ACE Inhibitor Pathway, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem
Function cysteine-type endopeptidase inhibitor activity; heparin binding; peptidase inhibitor activity; receptor binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KNG1 Products

Required fields are marked with *

My Review for All KNG1 Products

Required fields are marked with *

0
cart-icon