Recombinant Human KNG1 protein, T7/His-tagged
Cat.No. : | KNG1-70H |
Product Overview : | Recombinant Full-length heavy chain domain (HMWK) of human KNG1 cDNA (19 – 380 aa, derived from BC060039) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATK TVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQ YDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRMTYSIVQTNCSKENFLFL TPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKL NAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKI YPTVNCQPLGMISLMK |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro KNG1 H chain mediated endothelial cell differentiation / migration activities regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for KNG1 H chain protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. May be used for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | KNG1 kininogen 1 [ Homo sapiens ] |
Official Symbol | KNG1 |
Synonyms | KNG1; kininogen 1; BDK, kininogen , KNG; kininogen-1; alpha 2 thiol proteinase inhibitor; bradykinin; HMWK; fitzgerald factor; high molecular weight kininogen; alpha-2-thiol proteinase inhibitor; williams-Fitzgerald-Flaujeac factor; BDK; KNG; |
Gene ID | 3827 |
mRNA Refseq | NM_000893 |
Protein Refseq | NP_000884 |
MIM | 612358 |
UniProt ID | P01042 |
Chromosome Location | 3q21-qter |
Pathway | ACE Inhibitor Pathway, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem |
Function | cysteine-type endopeptidase inhibitor activity; heparin binding; peptidase inhibitor activity; receptor binding; zinc ion binding; |
◆ Recombinant Proteins | ||
KNG1-1435R | Recombinant Rat KNG1 Protein (390-639 aa), His-tagged | +Inquiry |
Kng1-1819R | Recombinant Rat Kng1 protein, His & GST-tagged | +Inquiry |
KNG1-60H | Recombinant Human KNG1 Protein, DYKDDDDK-tagged | +Inquiry |
Kng1-3300M | Active Recombinant Mouse Kng1 protein(Glu21-Ser480), His-tagged | +Inquiry |
Kng1-1818M | Recombinant Mouse Kng1 protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
KNG1-18H | Native Human Kininogen, LMW | +Inquiry |
KNG1-29338TH | Native Human KNG1 | +Inquiry |
KNG1-1844H | Native Human Kininogen 1 | +Inquiry |
KNG1-29146TH | Native Human KNG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KNG1-2284HCL | Recombinant Human KNG1 cell lysate | +Inquiry |
KNG1-2276MCL | Recombinant Mouse KNG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KNG1 Products
Required fields are marked with *
My Review for All KNG1 Products
Required fields are marked with *