Recombinant Human KPNA3 Protein, GST-tagged

Cat.No. : KPNA3-4895H
Product Overview : Human KPNA3 partial ORF ( NP_002258, 422 a.a. - 521 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : VKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KPNA3 karyopherin alpha 3 (importin alpha 4) [ Homo sapiens ]
Official Symbol KPNA3
Synonyms KPNA3; karyopherin alpha 3 (importin alpha 4); importin subunit alpha-3; hSRP1; IPOA4; SRP1gamma; SRP4; qip2; SRP1-gamma; importin alpha 4; importin alpha-3; importin alpha Q2; importin-alpha-Q2; karyopherin subunit alpha-3; SRP1;
Gene ID 3839
mRNA Refseq NM_002267
Protein Refseq NP_002258
MIM 601892
UniProt ID O00505

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KPNA3 Products

Required fields are marked with *

My Review for All KPNA3 Products

Required fields are marked with *

0
cart-icon