Recombinant Human KPNA3 Protein, GST-tagged
Cat.No. : | KPNA3-4895H |
Product Overview : | Human KPNA3 partial ORF ( NP_002258, 422 a.a. - 521 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KPNA3 karyopherin alpha 3 (importin alpha 4) [ Homo sapiens ] |
Official Symbol | KPNA3 |
Synonyms | KPNA3; karyopherin alpha 3 (importin alpha 4); importin subunit alpha-3; hSRP1; IPOA4; SRP1gamma; SRP4; qip2; SRP1-gamma; importin alpha 4; importin alpha-3; importin alpha Q2; importin-alpha-Q2; karyopherin subunit alpha-3; SRP1; |
Gene ID | 3839 |
mRNA Refseq | NM_002267 |
Protein Refseq | NP_002258 |
MIM | 601892 |
UniProt ID | O00505 |
◆ Recombinant Proteins | ||
KPNA3-29810TH | Recombinant Human KPNA3 | +Inquiry |
KPNA3-11467Z | Recombinant Zebrafish KPNA3 | +Inquiry |
KPNA3-4895H | Recombinant Human KPNA3 Protein, GST-tagged | +Inquiry |
Kpna3-1280M | Recombinant Mouse Kpna3 Protein, MYC/DDK-tagged | +Inquiry |
KPNA3-7882H | Recombinant Human KPNA3 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KPNA3-4890HCL | Recombinant Human KPNA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPNA3 Products
Required fields are marked with *
My Review for All KPNA3 Products
Required fields are marked with *