Recombinant Human KPNA3

Cat.No. : KPNA3-29810TH
Product Overview : Recombinant fragment of Human KPNA3 with an N terminal proprietary tag; Predicted MW 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Ubiquitous. Highest levels in heart and skeletal muscle.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF
Sequence Similarities : Belongs to the importin alpha family.Contains 10 ARM repeats.Contains 1 IBB domain.
Gene Name KPNA3 karyopherin alpha 3 (importin alpha 4) [ Homo sapiens ]
Official Symbol KPNA3
Synonyms KPNA3; karyopherin alpha 3 (importin alpha 4); importin subunit alpha-3; hSRP1; IPOA4; SRP1gamma; SRP4;
Gene ID 3839
mRNA Refseq NM_002267
Protein Refseq NP_002258
MIM 601892
Uniprot ID O00505
Chromosome Location 13q14.3
Pathway TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function nuclear localization sequence binding; protein C-terminus binding; protein binding; protein transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KPNA3 Products

Required fields are marked with *

My Review for All KPNA3 Products

Required fields are marked with *

0
cart-icon
0
compare icon