Recombinant Human KPNA3
Cat.No. : | KPNA3-29810TH |
Product Overview : | Recombinant fragment of Human KPNA3 with an N terminal proprietary tag; Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Ubiquitous. Highest levels in heart and skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF |
Sequence Similarities : | Belongs to the importin alpha family.Contains 10 ARM repeats.Contains 1 IBB domain. |
Gene Name | KPNA3 karyopherin alpha 3 (importin alpha 4) [ Homo sapiens ] |
Official Symbol | KPNA3 |
Synonyms | KPNA3; karyopherin alpha 3 (importin alpha 4); importin subunit alpha-3; hSRP1; IPOA4; SRP1gamma; SRP4; |
Gene ID | 3839 |
mRNA Refseq | NM_002267 |
Protein Refseq | NP_002258 |
MIM | 601892 |
Uniprot ID | O00505 |
Chromosome Location | 13q14.3 |
Pathway | TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function | nuclear localization sequence binding; protein C-terminus binding; protein binding; protein transporter activity; |
◆ Recombinant Proteins | ||
Kpna3-1280M | Recombinant Mouse Kpna3 Protein, MYC/DDK-tagged | +Inquiry |
KPNA3-4897M | Recombinant Mouse KPNA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
KPNA3-8799M | Recombinant Mouse KPNA3 Protein | +Inquiry |
KPNA3-4895H | Recombinant Human KPNA3 Protein, GST-tagged | +Inquiry |
KPNA3-4115C | Recombinant Chicken KPNA3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KPNA3-4890HCL | Recombinant Human KPNA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPNA3 Products
Required fields are marked with *
My Review for All KPNA3 Products
Required fields are marked with *