Recombinant Human KPNA4 Protein, GST-tagged
Cat.No. : | KPNA4-29909TH |
Product Overview : | Recombinant human KPNA4 full-length ORF ( NP_002259.1, 1 a.a. - 521 a.a.) protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognize NLSs and dock NLS-containing proteins to the nuclear pore complex. The protein encoded by this gene shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen. |
Molecular Mass : | 84.3 kDa |
AA Sequence : | MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KPNA4 |
Official Symbol | KPNA4 karyopherin subunit alpha 4 [ Homo sapiens (human) ] |
Synonyms | KPNA4; karyopherin subunit alpha 4; QIP1; SRP3; IPOA3; |
Gene ID | 3840 |
mRNA Refseq | NM_002268 |
Protein Refseq | NP_002259 |
MIM | 602970 |
UniProt ID | O00629 |
◆ Recombinant Proteins | ||
KPNA4-1719H | Recombinant Human KPNA4 Protein, His&GST-tagged | +Inquiry |
KPNA4-1262H | Recombinant Human KPNA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
KPNA4-1811C | Recombinant Chicken KPNA4 | +Inquiry |
KPNA4-29909TH | Recombinant Human KPNA4 Protein, GST-tagged | +Inquiry |
KPNA4-4898M | Recombinant Mouse KPNA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KPNA4-4889HCL | Recombinant Human KPNA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPNA4 Products
Required fields are marked with *
My Review for All KPNA4 Products
Required fields are marked with *