Recombinant Human KPNA5 protein, T7/His-tagged

Cat.No. : KPNA5-86H
Product Overview : Recombinant human KPNA5 cDNA ( 538aa, derived from BC047409 ) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQL FKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQV IQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNI AGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVL ADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHL LSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVA LGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKA FDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human KPNA5 mediated cellular protein cytoplasm/nuclei transportation regulation study by intracellularlly delivery this protein with "ProFectin" reagent.2. May be used for KPNA5 protein-protein interaction assay.3. May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name KPNA5 karyopherin alpha 5 (importin alpha 6) [ Homo sapiens ]
Official Symbol KPNA5
Synonyms KPNA5; karyopherin alpha 5 (importin alpha 6); importin subunit alpha-6; IPOA6; SRP6; importin alpha 6; karyopherin subunit alpha-5;
Gene ID 3841
mRNA Refseq NM_002269
Protein Refseq NP_002260
MIM 604545
UniProt ID O15131
Chromosome Location 6q22.2
Pathway Antiviral mechanism by IFN-stimulated genes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; ISG15 antiviral mechanism, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem;
Function binding; protein binding; protein transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KPNA5 Products

Required fields are marked with *

My Review for All KPNA5 Products

Required fields are marked with *

0
cart-icon