"KPNA5" Related Products

Expand
Expand

Recombinant Human KPNA5 protein, T7/His-tagged

Cat.No.: KPNA5-86H
Product Overview: Recombinant human KPNA5 cDNA ( 538aa, derived from BC047409 ) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQL FKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQV IQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNI AGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVL ADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHL LSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVA LGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKA FDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro human KPNA5 mediated cellular protein cytoplasm/nuclei transportation regulation study by intracellularlly delivery this protein with "ProFectin" reagent.2. May be used for KPNA5 protein-protein interaction assay.3. May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: KPNA5 karyopherin alpha 5 (importin alpha 6) [ Homo sapiens ]
Official Symbol: KPNA5
Synonyms: KPNA5; karyopherin alpha 5 (importin alpha 6); importin subunit alpha-6; IPOA6; SRP6; importin alpha 6; karyopherin subunit alpha-5;
Gene ID: 3841
mRNA Refseq: NM_002269
Protein Refseq: NP_002260
MIM: 604545
UniProt ID: O15131
Chromosome Location: 6q22.2
Pathway: Antiviral mechanism by IFN-stimulated genes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; ISG15 antiviral mechanism, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem;
Function: binding; protein binding; protein transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.