Recombinant Human KPNA5 protein, T7/His-tagged
| Cat.No. : | KPNA5-86H |
| Product Overview : | Recombinant human KPNA5 cDNA ( 538aa, derived from BC047409 ) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQL FKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQV IQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNI AGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVL ADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHL LSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVA LGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKA FDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro human KPNA5 mediated cellular protein cytoplasm/nuclei transportation regulation study by intracellularlly delivery this protein with "ProFectin" reagent.2. May be used for KPNA5 protein-protein interaction assay.3. May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | KPNA5 karyopherin alpha 5 (importin alpha 6) [ Homo sapiens ] |
| Official Symbol | KPNA5 |
| Synonyms | KPNA5; karyopherin alpha 5 (importin alpha 6); importin subunit alpha-6; IPOA6; SRP6; importin alpha 6; karyopherin subunit alpha-5; |
| Gene ID | 3841 |
| mRNA Refseq | NM_002269 |
| Protein Refseq | NP_002260 |
| MIM | 604545 |
| UniProt ID | O15131 |
| Chromosome Location | 6q22.2 |
| Pathway | Antiviral mechanism by IFN-stimulated genes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; ISG15 antiviral mechanism, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem; |
| Function | binding; protein binding; protein transporter activity; |
| ◆ Recombinant Proteins | ||
| KPNA5-5325H | Recombinant Human KPNA5 protein, GST-tagged | +Inquiry |
| KPNA5-2661Z | Recombinant Zebrafish KPNA5 | +Inquiry |
| KPNA5-5819HF | Recombinant Full Length Human KPNA5 Protein, GST-tagged | +Inquiry |
| KPNA5-4893H | Recombinant Human KPNA5 Protein, GST-tagged | +Inquiry |
| KPNA5-2377H | Recombinant Human KPNA5 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KPNA5-4888HCL | Recombinant Human KPNA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPNA5 Products
Required fields are marked with *
My Review for All KPNA5 Products
Required fields are marked with *
