Recombinant Human KRT14 protein, GST-tagged
| Cat.No. : | KRT14-30177H |
| Product Overview : | Recombinant Human KRT14 (262-472 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Gly262-Asn472 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | GQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | KRT14 keratin 14 [ Homo sapiens ] |
| Official Symbol | KRT14 |
| Synonyms | KRT14; keratin 14; EBS3, EBS4, keratin 14 (epidermolysis bullosa simplex, Dowling Meara, Koebner); keratin, type I cytoskeletal 14; epidermolysis bullosa simplex; Dowling Meara; Koebner; CK-14; keratin-14; cytokeratin 14; cytokeratin-14; keratin 14 (epidermolysis bullosa simplex, Dowling-Meara, Koebner); K14; NFJ; CK14; EBS3; EBS4; |
| Gene ID | 3861 |
| mRNA Refseq | NM_000526 |
| Protein Refseq | NP_000517 |
| MIM | 148066 |
| UniProt ID | P02533 |
| ◆ Recombinant Proteins | ||
| KRT14-4389H | Recombinant Human KRT14 Protein (Leu111-Leu418), N-His tagged | +Inquiry |
| Krt14-2731R | Recombinant Rat Krt14 protein, His & T7-tagged | +Inquiry |
| KRT14-2968R | Recombinant Rat KRT14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KRT14-30177H | Recombinant Human KRT14 protein, GST-tagged | +Inquiry |
| KRT14-4912M | Recombinant Mouse KRT14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KRT14-4880HCL | Recombinant Human KRT14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT14 Products
Required fields are marked with *
My Review for All KRT14 Products
Required fields are marked with *
