Recombinant Human KRT14 protein, GST-tagged

Cat.No. : KRT14-30177H
Product Overview : Recombinant Human KRT14 (262-472 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Gly262-Asn472
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : GQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name KRT14 keratin 14 [ Homo sapiens ]
Official Symbol KRT14
Synonyms KRT14; keratin 14; EBS3, EBS4, keratin 14 (epidermolysis bullosa simplex, Dowling Meara, Koebner); keratin, type I cytoskeletal 14; epidermolysis bullosa simplex; Dowling Meara; Koebner; CK-14; keratin-14; cytokeratin 14; cytokeratin-14; keratin 14 (epidermolysis bullosa simplex, Dowling-Meara, Koebner); K14; NFJ; CK14; EBS3; EBS4;
Gene ID 3861
mRNA Refseq NM_000526
Protein Refseq NP_000517
MIM 148066
UniProt ID P02533

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRT14 Products

Required fields are marked with *

My Review for All KRT14 Products

Required fields are marked with *

0
cart-icon