"KRT4" Related Products

Expand
Expand
Expand

Recombinant Human KRT4 protein, GST-tagged

Cat.No.: KRT4-29H
Product Overview: Recombinant Human KRT4(194 a.a. - 300 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in differentiated layers of the mucosal and esophageal epithelia with family member KRT13. Mutations in these genes have been associated with White Sponge Nevus, characterized by oral, esophageal, and anal leukoplakia. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 37.51 kDa
AA Sequence: SSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLN KVELEAKVDSLNDEINFLKVLYDAELSQMQTH
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: KRT4 keratin 4 [ Homo sapiens ]
Official Symbol: KRT4
Synonyms: KRT4; keratin 4; CYK4; keratin, type II cytoskeletal 4; CK4; cytokeratin 4; K4; keratin; type II cytoskeletal 4; type-II keratin Kb4; CK-4; FLJ31692;
Gene ID: 3851
mRNA Refseq: NM_002272
Protein Refseq: NP_002263
MIM: 123940
UniProt ID: P19013
Chromosome Location: 12q13.13
Function: structural molecule activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.