Recombinant Human KRT4 protein, GST-tagged
Cat.No. : | KRT4-29H |
Product Overview : | Recombinant Human KRT4(194 a.a. - 300 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 194-300 a.a. |
Description : | The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in differentiated layers of the mucosal and esophageal epithelia with family member KRT13. Mutations in these genes have been associated with White Sponge Nevus, characterized by oral, esophageal, and anal leukoplakia. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.51 kDa |
AA Sequence : | SSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLN KVELEAKVDSLNDEINFLKVLYDAELSQMQTH |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | KRT4 keratin 4 [ Homo sapiens ] |
Official Symbol | KRT4 |
Synonyms | KRT4; keratin 4; CYK4; keratin, type II cytoskeletal 4; CK4; cytokeratin 4; K4; keratin; type II cytoskeletal 4; type-II keratin Kb4; CK-4; FLJ31692; |
Gene ID | 3851 |
mRNA Refseq | NM_002272 |
Protein Refseq | NP_002263 |
MIM | 123940 |
UniProt ID | P19013 |
Chromosome Location | 12q13.13 |
Function | structural molecule activity; |
◆ Recombinant Proteins | ||
Krt4-1077M | Recombinant Mouse Krt4 Protein, His-tagged | +Inquiry |
KRT4-2979R | Recombinant Rat KRT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT4-29H | Recombinant Human KRT4 protein, GST-tagged | +Inquiry |
Krt4-2695R | Recombinant Rat Krt4 protein, His & S-tagged | +Inquiry |
KRT4-613H | Recombinant Human KRT4 Protein (1-534 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRT4-956HCL | Recombinant Human KRT4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT4 Products
Required fields are marked with *
My Review for All KRT4 Products
Required fields are marked with *