Recombinant Human KRT7 protein, His-SUMO-tagged
| Cat.No. : | KRT7-3151H |
| Product Overview : | Recombinant Human KRT7 protein(P08729)(2-469aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-469aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 67.3 kDa |
| AA Sequence : | SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | KRT7 keratin 7 [ Homo sapiens ] |
| Official Symbol | KRT7 |
| Synonyms | KRT7; keratin 7; keratin, type II cytoskeletal 7; CK7; cytokeratin 7; K2C7; K7; keratin; 55K type II cytoskeletal; type II cytoskeletal 7; sarcolectin; SCL; CK-7; keratin-7; cytokeratin-7; type-II keratin Kb7; type II mesothelial keratin K7; keratin, 55K type II cytoskeletal; keratin, simple epithelial type I, K7; MGC3625; MGC129731; |
| Gene ID | 3855 |
| mRNA Refseq | NM_005556 |
| Protein Refseq | NP_005547 |
| MIM | 148059 |
| UniProt ID | P08729 |
| ◆ Recombinant Proteins | ||
| KRT7-4387H | Recombinant Human KRT7 Protein (Glu91-Lys394), N-His tagged | +Inquiry |
| KRT7-6070HF | Recombinant Full Length Human KRT7 Protein, GST-tagged | +Inquiry |
| KRT7-3151H | Recombinant Human KRT7 protein, His-SUMO-tagged | +Inquiry |
| KRT7-3327R | Recombinant Rat KRT7 Protein | +Inquiry |
| KRT7-2447R | Recombinant Rhesus monkey KRT7 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KRT7-222HKCL | Human KRT7 Knockdown Cell Lysate | +Inquiry |
| KRT7-4864HCL | Recombinant Human KRT7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT7 Products
Required fields are marked with *
My Review for All KRT7 Products
Required fields are marked with *



