Recombinant Human KRT7 protein, His-SUMO-tagged

Cat.No. : KRT7-3151H
Product Overview : Recombinant Human KRT7 protein(P08729)(2-469aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 2-469aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 67.3 kDa
AA Sequence : SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name KRT7 keratin 7 [ Homo sapiens ]
Official Symbol KRT7
Synonyms KRT7; keratin 7; keratin, type II cytoskeletal 7; CK7; cytokeratin 7; K2C7; K7; keratin; 55K type II cytoskeletal; type II cytoskeletal 7; sarcolectin; SCL; CK-7; keratin-7; cytokeratin-7; type-II keratin Kb7; type II mesothelial keratin K7; keratin, 55K type II cytoskeletal; keratin, simple epithelial type I, K7; MGC3625; MGC129731;
Gene ID 3855
mRNA Refseq NM_005556
Protein Refseq NP_005547
MIM 148059
UniProt ID P08729

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRT7 Products

Required fields are marked with *

My Review for All KRT7 Products

Required fields are marked with *

0
cart-icon