Recombinant Human KRT7 protein, His-SUMO-tagged
Cat.No. : | KRT7-3151H |
Product Overview : | Recombinant Human KRT7 protein(P08729)(2-469aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-469aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 67.3 kDa |
AA Sequence : | SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | KRT7 keratin 7 [ Homo sapiens ] |
Official Symbol | KRT7 |
Synonyms | KRT7; keratin 7; keratin, type II cytoskeletal 7; CK7; cytokeratin 7; K2C7; K7; keratin; 55K type II cytoskeletal; type II cytoskeletal 7; sarcolectin; SCL; CK-7; keratin-7; cytokeratin-7; type-II keratin Kb7; type II mesothelial keratin K7; keratin, 55K type II cytoskeletal; keratin, simple epithelial type I, K7; MGC3625; MGC129731; |
Gene ID | 3855 |
mRNA Refseq | NM_005556 |
Protein Refseq | NP_005547 |
MIM | 148059 |
UniProt ID | P08729 |
◆ Recombinant Proteins | ||
KRT7-6070HF | Recombinant Full Length Human KRT7 Protein, GST-tagged | +Inquiry |
KRT7-2268R | Recombinant Rhesus Macaque KRT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT7-2983R | Recombinant Rat KRT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT7-2798H | Recombinant Human KRT7 protein, His & S-tagged | +Inquiry |
KRT7-4843H | Recombinant Human KRT7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRT7-4864HCL | Recombinant Human KRT7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT7 Products
Required fields are marked with *
My Review for All KRT7 Products
Required fields are marked with *