Recombinant Human KRT8 protein, GST-tagged
| Cat.No. : | KRT8-301413H |
| Product Overview : | Recombinant Human KRT8 (11-50 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Glu11-Leu50 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | EGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | KRT8 keratin 8 [ Homo sapiens ] |
| Official Symbol | KRT8 |
| Synonyms | KRT8; keratin 8; keratin, type II cytoskeletal 8; CARD2; CK8; CYK8; K2C8; K8; KO; cytokeratin 8; cytokeratin-8; type-II keratin Kb8; CK-8; |
| Gene ID | 3856 |
| mRNA Refseq | NM_001256282 |
| Protein Refseq | NP_001243211 |
| MIM | 148060 |
| UniProt ID | P05787 |
| ◆ Recombinant Proteins | ||
| Krt8-2124R | Recombinant Rat Krt8 protein, His & S-tagged | +Inquiry |
| KRT8-301413H | Recombinant Human KRT8 protein, GST-tagged | +Inquiry |
| KRT8-178H | Recombinant human KRT8 | +Inquiry |
| KRT8-3332R | Recombinant Rat KRT8 Protein | +Inquiry |
| Krt8-2123R | Recombinant Rat Krt8 protein, His & S-tagged | +Inquiry |
| ◆ Native Proteins | ||
| KRT8-177B | Native bovine KRT8 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KRT8-4862HCL | Recombinant Human KRT8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT8 Products
Required fields are marked with *
My Review for All KRT8 Products
Required fields are marked with *




