Recombinant Human KRT8 protein, GST-tagged

• Cat.No.: KRT8-301413H
• Product Overview: Recombinant Human KRT8 (11-50 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Glu11-Leu50
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: EGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: KRT8 keratin 8 [ Homo sapiens ]
• Official Symbol: KRT8
• Synonyms: KRT8; keratin 8; keratin, type II cytoskeletal 8; CARD2; CK8; CYK8; K2C8; K8; KO; cytokeratin 8; cytokeratin-8; type-II keratin Kb8; CK-8
• Gene ID: 3856
• mRNA Refseq: NM_001256282
• Protein Refseq: NP_001243211
• MIM: 148060
• UniProt ID: P05787