Recombinant Human L1CAM protein, His-tagged

Cat.No. : L1CAM-3153H
Product Overview : Recombinant Human L1CAM protein(P32004)(1003-1114aa), fused to N-terminal His tag, was expressed in E. coli.
Availability July 28, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1003-1114aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 16.5 kDa
AA Sequence : EAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name L1CAM L1 cell adhesion molecule [ Homo sapiens ]
Official Symbol L1CAM
Synonyms L1CAM; L1 cell adhesion molecule; antigen identified by monoclonal R1 , HSAS, HSAS1, MASA, MIC5, S10, SPG1; neural cell adhesion molecule L1; CD171; antigen identified by monoclonal R1; S10; HSAS; MASA; MIC5; SPG1; CAML1; HSAS1; N-CAML1; NCAM-L1; N-CAM-L1;
Gene ID 3897
mRNA Refseq NM_000425
Protein Refseq NP_000416
MIM 308840
UniProt ID P32004

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All L1CAM Products

Required fields are marked with *

My Review for All L1CAM Products

Required fields are marked with *

0
cart-icon
0
compare icon