Recombinant Human L1CAM protein, His-tagged
| Cat.No. : | L1CAM-3153H |
| Product Overview : | Recombinant Human L1CAM protein(P32004)(1003-1114aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1003-1114aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 16.5 kDa |
| AA Sequence : | EAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | L1CAM L1 cell adhesion molecule [ Homo sapiens ] |
| Official Symbol | L1CAM |
| Synonyms | L1CAM; L1 cell adhesion molecule; antigen identified by monoclonal R1 , HSAS, HSAS1, MASA, MIC5, S10, SPG1; neural cell adhesion molecule L1; CD171; antigen identified by monoclonal R1; S10; HSAS; MASA; MIC5; SPG1; CAML1; HSAS1; N-CAML1; NCAM-L1; N-CAM-L1; |
| Gene ID | 3897 |
| mRNA Refseq | NM_000425 |
| Protein Refseq | NP_000416 |
| MIM | 308840 |
| UniProt ID | P32004 |
| ◆ Recombinant Proteins | ||
| L1CAM-4399H | Recombinant Human L1CAM Protein, His&Myc-tagged | +Inquiry |
| L1CAM-485H | Active Recombinant Human L1CAM, Fc Chimera | +Inquiry |
| L1CAM-526HAF555 | Active Recombinant Human L1CAM Protein, His/Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| L1CAM-3758H | Recombinant Human L1CAM protein, GST-tagged | +Inquiry |
| L1CAM-3339R | Recombinant Rat L1CAM Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| L1CAM-2416HCL | Recombinant Human L1CAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All L1CAM Products
Required fields are marked with *
My Review for All L1CAM Products
Required fields are marked with *
