Recombinant Human L2HGDH Protein (52-463 aa), His-SUMO-tagged
| Cat.No. : | L2HGDH-1120H |
| Product Overview : | Recombinant Human L2HGDH Protein (52-463 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 52-463 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 61.3 kDa |
| AA Sequence : | VIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKLASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | L2HGDH L-2-hydroxyglutarate dehydrogenase [ Homo sapiens ] |
| Official Symbol | L2HGDH |
| Synonyms | L2HGDH; FLJ12618; duranin; C14orf160; |
| Gene ID | 79944 |
| mRNA Refseq | NM_024884 |
| Protein Refseq | NP_079160 |
| MIM | 609584 |
| UniProt ID | Q9H9P8 |
| ◆ Recombinant Proteins | ||
| L2HGDH-944H | Recombinant Human L2HGDH | +Inquiry |
| L2hgdh-3741M | Recombinant Mouse L2hgdh Protein, Myc/DDK-tagged | +Inquiry |
| L2HGDH-4798H | Recombinant Human L2HGDH protein, His-SUMO-tagged | +Inquiry |
| L2HGDH-7342Z | Recombinant Zebrafish L2HGDH | +Inquiry |
| L2HGDH-1120H | Recombinant Human L2HGDH Protein (52-463 aa), His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| L2HGDH-372HCL | Recombinant Human L2HGDH lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All L2HGDH Products
Required fields are marked with *
My Review for All L2HGDH Products
Required fields are marked with *
