Recombinant Human L3MBTL1 protein, His-tagged
| Cat.No. : | L3MBTL1-5743H |
| Product Overview : | Recombinant Human L3MBTL1 protein(420-772 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 420-772 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | DNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSASPGGCPPLSYRSLPHTRTSKYSFHHRKCPTPGCDGSGHVTGKFTAHHCLSGCPLAERNQSRLKAELSDSEASARKKNLSGFSPRKKPRHHGRIGRPPKYRKIPQEDFQTLTPDVVHQSLFMSALSAHPDRSLSVCWEQHCKLLPGVAGISASTVAKWTIDEVFGFVQTLTGCEDQARLFKDEARIVRVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETGVHSLLCSLPTHLLAKLSFASDSQY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | L3MBTL1 l(3)mbt-like 1 (Drosophila) [ Homo sapiens ] |
| Official Symbol | L3MBTL1 |
| Synonyms | L3MBTL1; l(3)mbt-like 1 (Drosophila); l(3)mbt (Drosophila) like , l(3)mbt like (Drosophila) , L3MBTL; lethal(3)malignant brain tumor-like protein 1; dJ138B7.3; DKFZp586P1522; KIAA0681; lethal (3) malignant brain tumor l(3); l(3)mbt protein homolog; L3MBTL; H-L(3)MBT; FLJ41181; |
| Gene ID | 26013 |
| mRNA Refseq | NM_015478 |
| Protein Refseq | NP_056293 |
| MIM | 608802 |
| UniProt ID | Q9Y468 |
| ◆ Recombinant Proteins | ||
| L3MBTL1-5743H | Recombinant Human L3MBTL1 protein, His-tagged | +Inquiry |
| L3MBTL1-255H | Recombinant Human CBX1 protein, GST-tagged | +Inquiry |
| L3MBTL1-125H | Recombinant Human L3MBTL1 Protein, His-tagged | +Inquiry |
| L3MBTL1-4970M | Recombinant Mouse L3MBTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| L3MBTL1-8916M | Recombinant Mouse L3MBTL1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| L3MBTL1-964HCL | Recombinant Human L3MBTL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All L3MBTL1 Products
Required fields are marked with *
My Review for All L3MBTL1 Products
Required fields are marked with *
