Recombinant Human L3MBTL1 protein, His-tagged

• Cat.No.: L3MBTL1-5743H
• Product Overview: Recombinant Human L3MBTL1 protein(420-772 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 420-772 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: DNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSASPGGCPPLSYRSLPHTRTSKYSFHHRKCPTPGCDGSGHVTGKFTAHHCLSGCPLAERNQSRLKAELSDSEASARKKNLSGFSPRKKPRHHGRIGRPPKYRKIPQEDFQTLTPDVVHQSLFMSALSAHPDRSLSVCWEQHCKLLPGVAGISASTVAKWTIDEVFGFVQTLTGCEDQARLFKDEARIVRVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETGVHSLLCSLPTHLLAKLSFASDSQY
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: L3MBTL1 l(3)mbt-like 1 (Drosophila) [ Homo sapiens ]
• Official Symbol: L3MBTL1
• Synonyms: L3MBTL1; l(3)mbt-like 1 (Drosophila); l(3)mbt (Drosophila) like , l(3)mbt like (Drosophila) , L3MBTL; lethal(3)malignant brain tumor-like protein 1; dJ138B7.3; DKFZp586P1522; KIAA0681; lethal (3) malignant brain tumor l(3); l(3)mbt protein homolog; L3MBTL; H-L(3)MBT; FLJ41181
• Gene ID: 26013
• mRNA Refseq: NM_015478
• Protein Refseq: NP_056293
• MIM: 608802
• UniProt ID: Q9Y468