Recombinant Human LAG3

Cat.No. : LAG3-101H
Product Overview : Human LAG3 full-length ORF (AAH52589.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4.
Form : Liquid
Molecular Mass : 39.1 kDa
AA Sequence : MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAA PGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAA VHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESF LFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTP PGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE
Applications : Antibody Production; Functional Study; Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name LAG3 lymphocyte-activation gene 3 [ Homo sapiens (human) ]
Official Symbol LAG3
Synonyms LAG3; CD223; lymphocyte-activation gene 3; lymphocyte activation gene 3 protein
Gene ID 3902
mRNA Refseq NM_002286
Protein Refseq NP_002277
MIM 153337
UniProt ID P18627
Chromosome Location 12p13.32
Function MHC class II protein binding; antigen binding; transmembrane signaling receptor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LAG3 Products

Required fields are marked with *

My Review for All LAG3 Products

Required fields are marked with *

0
cart-icon