Recombinant Human LAG3
| Cat.No. : | LAG3-101H |
| Product Overview : | Human LAG3 full-length ORF (AAH52589.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. |
| Form : | Liquid |
| Molecular Mass : | 39.1 kDa |
| AA Sequence : | MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAA PGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAA VHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESF LFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTP PGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE |
| Applications : | Antibody Production; Functional Study; Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | LAG3 lymphocyte-activation gene 3 [ Homo sapiens (human) ] |
| Official Symbol | LAG3 |
| Synonyms | LAG3; CD223; lymphocyte-activation gene 3; lymphocyte activation gene 3 protein |
| Gene ID | 3902 |
| mRNA Refseq | NM_002286 |
| Protein Refseq | NP_002277 |
| MIM | 153337 |
| UniProt ID | P18627 |
| Chromosome Location | 12p13.32 |
| Function | MHC class II protein binding; antigen binding; transmembrane signaling receptor activity |
| ◆ Recombinant Proteins | ||
| LAG3-269HF | Recombinant Full Length Human LAG3 Protein | +Inquiry |
| LAG3-103H | Recombinant Human LAG3, GST-tagged | +Inquiry |
| LAG3-1830H | Recombinant Human LAG3 protein, hFc-tagged | +Inquiry |
| LAG3-467H | Recombinant Human LAG3 protein(Met1-Arg440) | +Inquiry |
| LAG3-616H | Recombinant Human LAG3 Protein (29-450 aa), His-GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LAG3-941RCL | Recombinant Rat LAG3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAG3 Products
Required fields are marked with *
My Review for All LAG3 Products
Required fields are marked with *
