Recombinant Human LAIR2

Cat.No. : LAIR2-29000TH
Product Overview : Recombinant full length Human LAIR2 with N terminal proprietary tag; Predicted MW 42.79 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 152 amino acids
Description : The protein encoded by this gene is a member of the immunoglobulin superfamily. It was identified by its similarity to LAIR1, an inhibitory receptor present on mononuclear leukocytes. This gene maps to a region of 19q13.4, termed the leukocyte receptor cluster, which contains 29 genes in the immunoglobulin superfamily, including LAIR1. The function of this protein is unknown, although it is thought to be secreted and may help modulate mucosal tolerance. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 42.790kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVIS PGSHVTFMCRGPVGVQTFRLEREDRAKYKDSYNVFRLGPS ESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLV KESSGGPDSPDTEPGSSAGTVPGTEASGFDAP
Sequence Similarities : Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Gene Name LAIR2 leukocyte-associated immunoglobulin-like receptor 2 [ Homo sapiens ]
Official Symbol LAIR2
Synonyms LAIR2; leukocyte-associated immunoglobulin-like receptor 2; leukocyte associated Ig like receptor 2; CD306;
Gene ID 3904
mRNA Refseq NM_002288
Protein Refseq NP_002279
MIM 602993
Uniprot ID Q6ISS4
Chromosome Location 19q13.4
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LAIR2 Products

Required fields are marked with *

My Review for All LAIR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon