Recombinant Human LAMB1 Protein (1533-1782 aa), His-SUMO-tagged

Cat.No. : LAMB1-2563H
Product Overview : Recombinant Human LAMB1 Protein (1533-1782 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1533-1782 aa
Description : Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Involved in the organization of the laminar architecture of cerebral cortex. It is probably required for the integrity of the basement membrane/glia limitans that serves as an anchor point for the endfeet of radial glial cells and as a physical barrier to migrating neurons. Radial glial cells play a central role in cerebral cortical development, where they act both as the proliferative unit of the cerebral cortex and a scaffold for neurons migrating toward the pial surface.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 44.3 kDa
AA Sequence : MPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDALERKYEDNQRYLEDKAQELARLEGEVRSLLKDAISQKVAVY
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name LAMB1 laminin, beta 1 [ Homo sapiens ]
Official Symbol LAMB1
Synonyms LAMB1; laminin, beta 1; laminin subunit beta-1; laminin B1 chain; CLM; MGC142015;
Gene ID 3912
mRNA Refseq NM_002291
Protein Refseq NP_002282
MIM 150240
UniProt ID P07942

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LAMB1 Products

Required fields are marked with *

My Review for All LAMB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon