Recombinant Human LAMP2

Cat.No. : LAMP2-27946TH
Product Overview : Recombinant fragment corresponding to amino acids 30-127 of Human LAMP2 with a N terminal propriatery tag; predicted MWt 6.41 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins.
Molecular Weight : 36.410kDa inclusive of tags
Tissue specificity : Isoform LAMP-2A is highly expressed in placenta, lung and liver, less in kidney and pancreas, low in brain and skeletal muscle. Isoform LAMP-2B is highly expressed in skeletal muscle, less in brain, placenta, lung, kidney and pancreas, very low in liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP
Sequence Similarities : Belongs to the LAMP family.
Gene Name LAMP2 lysosomal-associated membrane protein 2 [ Homo sapiens ]
Official Symbol LAMP2
Synonyms LAMP2; lysosomal-associated membrane protein 2; lysosome-associated membrane glycoprotein 2; CD107b;
Gene ID 3920
mRNA Refseq NM_001122606
Protein Refseq NP_001116078
MIM 309060
Uniprot ID P13473
Chromosome Location Xq24-q25
Pathway Hemostasis, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LAMP2 Products

Required fields are marked with *

My Review for All LAMP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon