Recombinant Human LAMP2 protein, His-tagged
| Cat.No. : | LAMP2-2871H |
| Product Overview : | Recombinant Human LAMP2 protein(29 - 230 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 29 - 230 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGND |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | LAMP2 lysosomal-associated membrane protein 2 [ Homo sapiens ] |
| Official Symbol | LAMP2 |
| Synonyms | LAMP2; lysosomal-associated membrane protein 2; lysosome-associated membrane glycoprotein 2; CD107b; CD107 antigen-like family member B; lysosome-associated membrane protein 2; LAMPB; LAMP-2; LGP110; |
| Gene ID | 3920 |
| mRNA Refseq | NM_001122606 |
| Protein Refseq | NP_001116078 |
| MIM | 309060 |
| UniProt ID | P13473 |
| ◆ Recombinant Proteins | ||
| Lamp2-6974M | Recombinant Mouse Lamp2 protein(Leu26-Asn379), His-tagged | +Inquiry |
| RFL4114RF | Recombinant Full Length Rat Lysosome-Associated Membrane Glycoprotein 2(Lamp2) Protein, His-Tagged | +Inquiry |
| LAMP2-2871H | Recombinant Human LAMP2 protein, His-tagged | +Inquiry |
| LAMP2-3727H | Recombinant Human LAMP2 protein, GST-tagged | +Inquiry |
| LAMP2-170HFL | Recombinant Full Length Human LAMP2 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LAMP2-1756MCL | Recombinant Mouse LAMP2 cell lysate | +Inquiry |
| LAMP2-987CCL | Recombinant Cynomolgus LAMP2 cell lysate | +Inquiry |
| LAMP2-363HKCL | Human LAMP2 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAMP2 Products
Required fields are marked with *
My Review for All LAMP2 Products
Required fields are marked with *
