Recombinant Human LAMTOR4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LAMTOR4-6465H
Product Overview : C7orf59 MS Standard C13 and N15-labeled recombinant protein (NP_001008396) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : LAMTOR4 (Late Endosomal/Lysosomal Adaptor, MAPK And MTOR Activator 4) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and RET signaling. Gene Ontology (GO) annotations related to this gene include guanyl-nucleotide exchange factor activity and protein-containing complex scaffold activity.
Molecular Mass : 10.7 kDa
AA Sequence : MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LAMTOR4 late endosomal/lysosomal adaptor, MAPK and MTOR activator 4 [ Homo sapiens (human) ]
Official Symbol LAMTOR4
Synonyms LAMTOR4; late endosomal/lysosomal adaptor, MAPK and MTOR activator 4; C7orf59; ragulator complex protein LAMTOR4; UPF0539 protein C7orf59; late endosomal/lysosomal adaptor and MAPK and MTOR activator 4
Gene ID 389541
mRNA Refseq NM_001008395
Protein Refseq NP_001008396
MIM 618834
UniProt ID Q0VGL1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LAMTOR4 Products

Required fields are marked with *

My Review for All LAMTOR4 Products

Required fields are marked with *

0
cart-icon