Recombinant Human LAMTOR4 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LAMTOR4-6465H |
| Product Overview : | C7orf59 MS Standard C13 and N15-labeled recombinant protein (NP_001008396) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | LAMTOR4 (Late Endosomal/Lysosomal Adaptor, MAPK And MTOR Activator 4) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and RET signaling. Gene Ontology (GO) annotations related to this gene include guanyl-nucleotide exchange factor activity and protein-containing complex scaffold activity. |
| Molecular Mass : | 10.7 kDa |
| AA Sequence : | MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LAMTOR4 late endosomal/lysosomal adaptor, MAPK and MTOR activator 4 [ Homo sapiens (human) ] |
| Official Symbol | LAMTOR4 |
| Synonyms | LAMTOR4; late endosomal/lysosomal adaptor, MAPK and MTOR activator 4; C7orf59; ragulator complex protein LAMTOR4; UPF0539 protein C7orf59; late endosomal/lysosomal adaptor and MAPK and MTOR activator 4 |
| Gene ID | 389541 |
| mRNA Refseq | NM_001008395 |
| Protein Refseq | NP_001008396 |
| MIM | 618834 |
| UniProt ID | Q0VGL1 |
| ◆ Recombinant Proteins | ||
| LAMTOR4-0152H | Recombinant Human LAMTOR4 Protein, GST-Tagged | +Inquiry |
| Lamtor4-3751M | Recombinant Mouse Lamtor4 Protein, Myc/DDK-tagged | +Inquiry |
| LAMTOR4-2630HF | Recombinant Full Length Human LAMTOR4 Protein, GST-tagged | +Inquiry |
| LAMTOR4-6465H | Recombinant Human LAMTOR4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LAMTOR4-1381H | Recombinant Human LAMTOR4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAMTOR4 Products
Required fields are marked with *
My Review for All LAMTOR4 Products
Required fields are marked with *
