Recombinant Human LAMTOR4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LAMTOR4-6465H
• Product Overview: C7orf59 MS Standard C13 and N15-labeled recombinant protein (NP_001008396) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: LAMTOR4 (Late Endosomal/Lysosomal Adaptor, MAPK And MTOR Activator 4) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and RET signaling. Gene Ontology (GO) annotations related to this gene include guanyl-nucleotide exchange factor activity and protein-containing complex scaffold activity.
• Molecular Mass: 10.7 kDa
• AA Sequence: MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LAMTOR4 late endosomal/lysosomal adaptor, MAPK and MTOR activator 4 [ Homo sapiens (human) ]
• Official Symbol: LAMTOR4
• Synonyms: LAMTOR4; late endosomal/lysosomal adaptor, MAPK and MTOR activator 4; C7orf59; ragulator complex protein LAMTOR4; UPF0539 protein C7orf59; late endosomal/lysosomal adaptor and MAPK and MTOR activator 4
• Gene ID: 389541
• mRNA Refseq: NM_001008395
• Protein Refseq: NP_001008396
• MIM: 618834
• UniProt ID: Q0VGL1