Recombinant Human LAMTOR4 Protein, GST-Tagged
Cat.No. : | LAMTOR4-0152H |
Product Overview : | Human LAMTOR4 full-length ORF (ADR82787.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | LAMTOR4 (Late Endosomal/Lysosomal Adaptor, MAPK And MTOR Activator 4) is a Protein Coding gene. Among its related pathways are RET signaling and PI3K / Akt Signaling. GO annotations related to this gene include guanyl-nucleotide exchange factor activity and protein complex scaffold. |
Molecular Mass : | 10.9 kDa |
AA Sequence : | MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LAMTOR4 late endosomal/lysosomal adaptor, MAPK and MTOR activator 4 [ Homo sapiens (human) ] |
Official Symbol | LAMTOR4 |
Synonyms | LAMTOR4; late endosomal/lysosomal adaptor, MAPK and MTOR activator 4; Late Endosomal/Lysosomal Adaptor, MAPK And MTOR Activator 4; Late Endosomal/Lysosomal Adaptor And MAPK And MTOR Activator 4; C7orf59 3; Chromosome 7 Open Reading Frame 59; Ragulator Complex Protein LAMTOR4; UPF0539 Protein C7orf59; |
Gene ID | 389541 |
mRNA Refseq | NM_001008395 |
Protein Refseq | NP_001008396 |
UniProt ID | Q0VGL1 |
◆ Recombinant Proteins | ||
LAMTOR4-2630HF | Recombinant Full Length Human LAMTOR4 Protein, GST-tagged | +Inquiry |
LAMTOR4-0152H | Recombinant Human LAMTOR4 Protein, GST-Tagged | +Inquiry |
LAMTOR4-1381H | Recombinant Human LAMTOR4 | +Inquiry |
LAMTOR4-3331H | Recombinant Human LAMTOR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAMTOR4-161H | Recombinant Human LAMTOR4 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAMTOR4 Products
Required fields are marked with *
My Review for All LAMTOR4 Products
Required fields are marked with *
0
Inquiry Basket