Recombinant Human LAMTOR4 Protein, GST-Tagged

• Cat.No.: LAMTOR4-0152H
• Product Overview: Human LAMTOR4 full-length ORF (ADR82787.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LAMTOR4 (Late Endosomal/Lysosomal Adaptor, MAPK And MTOR Activator 4) is a Protein Coding gene. Among its related pathways are RET signaling and PI3K / Akt Signaling. GO annotations related to this gene include guanyl-nucleotide exchange factor activity and protein complex scaffold.
• Molecular Mass: 10.9 kDa
• AA Sequence: MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LAMTOR4 late endosomal/lysosomal adaptor, MAPK and MTOR activator 4 [ Homo sapiens (human) ]
• Official Symbol: LAMTOR4
• Synonyms: LAMTOR4; late endosomal/lysosomal adaptor, MAPK and MTOR activator 4; Late Endosomal/Lysosomal Adaptor, MAPK And MTOR Activator 4; Late Endosomal/Lysosomal Adaptor And MAPK And MTOR Activator 4; C7orf59 3; Chromosome 7 Open Reading Frame 59; Ragulator Complex Protein LAMTOR4; UPF0539 Protein C7orf59
• Gene ID: 389541
• mRNA Refseq: NM_001008395
• Protein Refseq: NP_001008396
• UniProt ID: Q0VGL1