Recombinant Full Length Human LAMTOR4 Protein, GST-tagged
| Cat.No. : | LAMTOR4-2630HF |
| Product Overview : | Human LAMTOR4 full-length ORF (ADR82787.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 99 amino acids |
| Description : | LAMTOR4 (Late Endosomal/Lysosomal Adaptor, MAPK And MTOR Activator 4) is a Protein Coding gene. Among its related pathways are RET signaling and PI3K / Akt Signaling. GO annotations related to this gene include guanyl-nucleotide exchange factor activity and protein complex scaffold. |
| Molecular Mass : | 10.9 kDa |
| AA Sequence : | MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LAMTOR4 late endosomal/lysosomal adaptor, MAPK and MTOR activator 4 [ Homo sapiens (human) ] |
| Official Symbol | LAMTOR4 |
| Synonyms | LAMTOR4; late endosomal/lysosomal adaptor, MAPK and MTOR activator 4; Late Endosomal/Lysosomal Adaptor, MAPK And MTOR Activator 4; Late Endosomal/Lysosomal Adaptor And MAPK And MTOR Activator 4; C7orf59 3; Chromosome 7 Open Reading Frame 59; Ragulator Complex Protein LAMTOR4; UPF0539 Protein C7orf59; |
| Gene ID | 389541 |
| mRNA Refseq | NM_001008395 |
| Protein Refseq | NP_001008396 |
| MIM | 618834 |
| UniProt ID | Q0VGL1 |
| ◆ Recombinant Proteins | ||
| LAMTOR4-0152H | Recombinant Human LAMTOR4 Protein, GST-Tagged | +Inquiry |
| LAMTOR4-6465H | Recombinant Human LAMTOR4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LAMTOR4-1381H | Recombinant Human LAMTOR4 | +Inquiry |
| LAMTOR4-161H | Recombinant Human LAMTOR4 Protein, MYC/DDK-tagged | +Inquiry |
| Lamtor4-3751M | Recombinant Mouse Lamtor4 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAMTOR4 Products
Required fields are marked with *
My Review for All LAMTOR4 Products
Required fields are marked with *
