Recombinant Human LCN1

Cat.No. : LCN1-29220TH
Product Overview : Recombinant full length Human LCN1 (amino acids 1-176) with N terminal proprietary tag, 45.43 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 176 amino acids
Description : The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception.
Molecular Weight : 45.430kDa inclusive of tags
Tissue specificity : Mainly expressed in lachrymal and salivary glands. Also expressed in the prostate.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAM TVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQ EVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE GELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTE SILIPRQSETCSPGSD
Sequence Similarities : Belongs to the calycin superfamily. Lipocalin family.
Gene Name LCN1 lipocalin 1 [ Homo sapiens ]
Official Symbol LCN1
Synonyms LCN1; lipocalin 1; lipocalin 1 (protein migrating faster than albumin, tear prealbumin) , lipocalin 1 (tear prealbumin); lipocalin-1; lipocalin 1 like 2; MGC71975; PMFA; tear lipocalin; tear prealbumin; TP; VEGP; Von Ebner gland protein;
Gene ID 3933
mRNA Refseq NM_002297
Protein Refseq NP_002288
MIM 151675
Uniprot ID P31025
Chromosome Location 9q34
Function binding; cysteine-type endopeptidase inhibitor activity; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LCN1 Products

Required fields are marked with *

My Review for All LCN1 Products

Required fields are marked with *

0
cart-icon