Recombinant Pig LCN1 protein, His-tagged
Cat.No. : | LCN1-785P |
Product Overview : | Recombinant Pig LCN1 protein(P53715)(20-176aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-176a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QEFPAVGQPLQDLLGRWYLKAMTSDPEIPGKKPESVTPLILKALEGGDLEAQITFLIDGQCQDVTLVLKKTNQPFTFTAYDGKRVVYILPSKVKDHYILYCEGELDGQEVRMAKLVGRDPENNPEALEEFKEVARAKGLNPDIVRPQQSETCSPGGN |
Gene Name | LCN1 lipocalin 1 [ Sus scrofa ] |
Official Symbol | LCN1 |
Synonyms | LCN1; lipocalin 1; lipocalin-1; TP; tlc; tear lipocalin; tear prealbumin; Von Ebner gland protein; lipocalin 1 (tear prealbumin); von Ebners lingual gland protein; VEG; VEGP; |
Gene ID | 396861 |
mRNA Refseq | NM_213856 |
Protein Refseq | NP_999021 |
◆ Recombinant Proteins | ||
LCN1-4422H | Recombinant Human LCN1 Protein (Ser24-Ser172), N-His tagged | +Inquiry |
LCN1-277HF | Recombinant Full Length Human LCN1 Protein Protein | +Inquiry |
LCN1-593H | Recombinant Human lipocalin 1, His-tagged | +Inquiry |
LCN1-2719H | Recombinant Human LCN1 protein(31-100 aa), C-His-tagged | +Inquiry |
LCN1-3216H | Recombinant Human LCN1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCN1-2211HCL | Recombinant Human LCN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCN1 Products
Required fields are marked with *
My Review for All LCN1 Products
Required fields are marked with *