Recombinant Human LCN1 protein(31-100 aa), C-His-tagged
Cat.No. : | LCN1-2719H |
Product Overview : | Recombinant Human LCN1 protein(P31025)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-100 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | VSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGG |
Gene Name | LCN1 lipocalin 1 [ Homo sapiens ] |
Official Symbol | LCN1 |
Synonyms | LCN1; lipocalin 1; lipocalin 1 (protein migrating faster than albumin, tear prealbumin) , lipocalin 1 (tear prealbumin); lipocalin-1; lipocalin 1 like 2; MGC71975; PMFA; tear lipocalin; tear prealbumin; TLC; TP; VEGP; Von Ebner gland protein; VEG protein; lipocalin 1 (tear prealbumin); protein migrating faster than albumin; |
Gene ID | 3933 |
mRNA Refseq | NM_001252618 |
Protein Refseq | NP_001239547 |
MIM | 151675 |
UniProt ID | P31025 |
◆ Recombinant Proteins | ||
LCN1-3216H | Recombinant Human LCN1 protein, His-tagged | +Inquiry |
LCN1-593H | Recombinant Human lipocalin 1, His-tagged | +Inquiry |
LCN1-277HF | Recombinant Full Length Human LCN1 Protein Protein | +Inquiry |
LCN1-785P | Recombinant Pig LCN1 protein, His-tagged | +Inquiry |
LCN1-29847TH | Recombinant Human LCN1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCN1-2211HCL | Recombinant Human LCN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LCN1 Products
Required fields are marked with *
My Review for All LCN1 Products
Required fields are marked with *
0
Inquiry Basket