Recombinant Human LCN1 protein(31-100 aa), C-His-tagged

Cat.No. : LCN1-2719H
Product Overview : Recombinant Human LCN1 protein(P31025)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 31-100 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : VSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGG
Gene Name LCN1 lipocalin 1 [ Homo sapiens ]
Official Symbol LCN1
Synonyms LCN1; lipocalin 1; lipocalin 1 (protein migrating faster than albumin, tear prealbumin) , lipocalin 1 (tear prealbumin); lipocalin-1; lipocalin 1 like 2; MGC71975; PMFA; tear lipocalin; tear prealbumin; TLC; TP; VEGP; Von Ebner gland protein; VEG protein; lipocalin 1 (tear prealbumin); protein migrating faster than albumin;
Gene ID 3933
mRNA Refseq NM_001252618
Protein Refseq NP_001239547
MIM 151675
UniProt ID P31025

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LCN1 Products

Required fields are marked with *

My Review for All LCN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon