Recombinant Human LCN1
Cat.No. : | LCN1-29847TH |
Product Overview : | Recombinant fragment: SDEEIQDVSG TWYLKAMTVD REFPEMNLES VTPMTLTTLE GGNLEAKVTM LISGRCQEVK AVLEKTDEPG KYTADGGKHV AYIIRSHVKD HYIFYCE of Human LCN1 (amino acids 24-120) with N terminal proprietary tag, 36.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 97 amino acids |
Description : | The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception. |
Molecular Weight : | 36.300kDa inclusive of tags |
Tissue specificity : | Mainly expressed in lachrymal and salivary glands. Also expressed in the prostate. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE |
Sequence Similarities : | Belongs to the calycin superfamily. Lipocalin family. |
Gene Name | LCN1 lipocalin 1 [ Homo sapiens ] |
Official Symbol | LCN1 |
Synonyms | LCN1; lipocalin 1; lipocalin 1 (protein migrating faster than albumin, tear prealbumin) , lipocalin 1 (tear prealbumin); lipocalin-1; lipocalin 1 like 2; MGC71975; PMFA; tear lipocalin; tear prealbumin; TP; VEGP; Von Ebner gland protein; |
Gene ID | 3933 |
mRNA Refseq | NM_002297 |
Protein Refseq | NP_002288 |
MIM | 151675 |
Uniprot ID | P31025 |
Chromosome Location | 9q34 |
Function | binding; cysteine-type endopeptidase inhibitor activity; transporter activity; |
◆ Recombinant Proteins | ||
LCN1-3216H | Recombinant Human LCN1 protein, His-tagged | +Inquiry |
LCN1-277HF | Recombinant Full Length Human LCN1 Protein Protein | +Inquiry |
LCN1-29220TH | Recombinant Human LCN1 | +Inquiry |
LCN1-785P | Recombinant Pig LCN1 protein, His-tagged | +Inquiry |
LCN1-2719H | Recombinant Human LCN1 protein(31-100 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCN1-2211HCL | Recombinant Human LCN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCN1 Products
Required fields are marked with *
My Review for All LCN1 Products
Required fields are marked with *