Recombinant Full Length Human LCN1 Protein Protein
Cat.No. : | LCN1-277HF |
Product Overview : | Recombinant full length Human LCN1 (amino acids 1-176) with N terminal proprietary tag, 45.43 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 176 amino acids |
Description : | The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception. |
Form : | Liquid |
Molecular Mass : | 45.430kDa inclusive of tags |
AA Sequence : | MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAM TVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQ EVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE GELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTE SILIPRQSETCSPGSD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | LCN1 lipocalin 1 [ Homo sapiens ] |
Official Symbol | LCN1 |
Synonyms | LCN1; lipocalin 1; lipocalin 1 (protein migrating faster than albumin, tear prealbumin) , lipocalin 1 (tear prealbumin); lipocalin-1; lipocalin 1 like 2; MGC71975; PMFA; tear lipocalin; tear prealbumin; TP; VEGP; Von Ebner gland protein |
Gene ID | 3933 |
mRNA Refseq | NM_002297 |
Protein Refseq | NP_002288 |
MIM | 151675 |
UniProt ID | P31025 |
◆ Recombinant Proteins | ||
LCN1-2476R | Recombinant Rhesus monkey LCN1 Protein, His-tagged | +Inquiry |
Lcn1-1826R | Recombinant Rat Lcn1 protein, His & T7-tagged | +Inquiry |
LCN1-3216H | Recombinant Human LCN1 protein, His-tagged | +Inquiry |
LCN1-29847TH | Recombinant Human LCN1 | +Inquiry |
LCN1-785P | Recombinant Pig LCN1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCN1-2211HCL | Recombinant Human LCN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LCN1 Products
Required fields are marked with *
My Review for All LCN1 Products
Required fields are marked with *
0
Inquiry Basket