Recombinant Human LCN12 protein, GST-tagged
Cat.No. : | LCN12-6754H |
Product Overview : | Recombinant Human LCN12 protein(36-85 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 36-85 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | LCN12 lipocalin 12 [ Homo sapiens ] |
Official Symbol | LCN12 |
Synonyms | LCN12; lipocalin 12; epididymal-specific lipocalin-12; MGC48935; lipocalcin 12; MGC34753; |
Gene ID | 286256 |
mRNA Refseq | NM_178536 |
Protein Refseq | NP_848631 |
MIM | 612905 |
UniProt ID | Q6JVE5 |
◆ Recombinant Proteins | ||
LCN12-2298R | Recombinant Rhesus Macaque LCN12 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lcn12-501M | Recombinant Mouse Lcn12 Protein, His/GST-tagged | +Inquiry |
LCN12-4212H | Recombinant Human LCN12 Protein (Leu61-Gly184), N-GST tagged | +Inquiry |
LCN12-500H | Recombinant Human LCN12 Protein, His/GST-tagged | +Inquiry |
Lcn12-502R | Recombinant Rat Lcn12 Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCN12-975HCL | Recombinant Human LCN12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCN12 Products
Required fields are marked with *
My Review for All LCN12 Products
Required fields are marked with *
0
Inquiry Basket