Recombinant Human LCN6 protein, His-tagged
Cat.No. : | LCN6-365H |
Product Overview : | Recombinant Human LCN6 protein(P62502)(21-163aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-163aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | VWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLRTLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSRSLGFLSQ |
Gene Name | LCN6 lipocalin 6 [ Homo sapiens ] |
Official Symbol | LCN6 |
Synonyms | LCN6; lipocalin 6; |
Gene ID | 140800 |
MIM | 609379 |
UniProt ID | P62502 |
◆ Recombinant Proteins | ||
LCN6-4602H | Recombinant Human LCN6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LCN6-1468HFL | Recombinant Full Length Human LCN6 Protein, C-Flag-tagged | +Inquiry |
LCN6-2479R | Recombinant Rhesus monkey LCN6 Protein, His-tagged | +Inquiry |
Lcn6-3761M | Recombinant Mouse Lcn6 Protein, Myc/DDK-tagged | +Inquiry |
LCN6-1280H | Recombinant Human LCN6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCN6-4799HCL | Recombinant Human LCN6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCN6 Products
Required fields are marked with *
My Review for All LCN6 Products
Required fields are marked with *