Recombinant Human LCN6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LCN6-4602H
Product Overview : LCN6 MS Standard C13 and N15-labeled recombinant protein (NP_945184) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May play a role in male fertility.
Molecular Mass : 18 kDa
AA Sequence : MGGLLLAAFLALVSVPRAQAVWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLRTLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSRSLGFLSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LCN6 lipocalin 6 [ Homo sapiens (human) ]
Official Symbol LCN6
Synonyms LCN6; lipocalin 6; LCN5; hLcn5; UNQ643; epididymal-specific lipocalin-6; epididymal-specific lipocalin LCN6; epididymis secretory sperm binding protein; lipocalin 5
Gene ID 158062
mRNA Refseq NM_198946
Protein Refseq NP_945184
MIM 609379
UniProt ID P62502

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LCN6 Products

Required fields are marked with *

My Review for All LCN6 Products

Required fields are marked with *

0
cart-icon
0
compare icon