Recombinant Human LCN6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LCN6-4602H
• Product Overview: LCN6 MS Standard C13 and N15-labeled recombinant protein (NP_945184) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: May play a role in male fertility.
• Molecular Mass: 18 kDa
• AA Sequence: MGGLLLAAFLALVSVPRAQAVWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLRTLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSRSLGFLSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LCN6 lipocalin 6 [ Homo sapiens (human) ]
• Official Symbol: LCN6
• Synonyms: LCN6; lipocalin 6; LCN5; hLcn5; UNQ643; epididymal-specific lipocalin-6; epididymal-specific lipocalin LCN6; epididymis secretory sperm binding protein; lipocalin 5
• Gene ID: 158062
• mRNA Refseq: NM_198946
• Protein Refseq: NP_945184
• MIM: 609379
• UniProt ID: P62502