Recombinant Human LCN6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LCN6-4602H |
Product Overview : | LCN6 MS Standard C13 and N15-labeled recombinant protein (NP_945184) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May play a role in male fertility. |
Molecular Mass : | 18 kDa |
AA Sequence : | MGGLLLAAFLALVSVPRAQAVWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLRTLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSRSLGFLSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LCN6 lipocalin 6 [ Homo sapiens (human) ] |
Official Symbol | LCN6 |
Synonyms | LCN6; lipocalin 6; LCN5; hLcn5; UNQ643; epididymal-specific lipocalin-6; epididymal-specific lipocalin LCN6; epididymis secretory sperm binding protein; lipocalin 5 |
Gene ID | 158062 |
mRNA Refseq | NM_198946 |
Protein Refseq | NP_945184 |
MIM | 609379 |
UniProt ID | P62502 |
◆ Recombinant Proteins | ||
LCN6-4602H | Recombinant Human LCN6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LCN6-2388H | Recombinant Human LCN6 Protein, His-tagged | +Inquiry |
LCN6-2300R | Recombinant Rhesus Macaque LCN6 Protein, His (Fc)-Avi-tagged | +Inquiry |
LCN6-1280H | Recombinant Human LCN6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lcn6-1149R | Recombinant Rat Lcn6 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCN6-4799HCL | Recombinant Human LCN6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCN6 Products
Required fields are marked with *
My Review for All LCN6 Products
Required fields are marked with *