Recombinant Human LDHAL6B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LDHAL6B-2953H |
Product Overview : | LDHAL6B MS Standard C13 and N15-labeled recombinant protein (NP_149972) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | LDHAL6B (Lactate Dehydrogenase A Like 6B) is a Protein Coding gene. Diseases associated with LDHAL6B include Hodgkin's Lymphoma, Lymphocytic Depletion and Methotrexate-Associated Lymphoproliferation. Among its related pathways are Glucose metabolism and Pyruvate metabolism and Citric Acid (TCA) cycle. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and L-lactate dehydrogenase activity. An important paralog of this gene is LDHAL6A. |
Molecular Mass : | 42 kDa |
AA Sequence : | MSWTVPVVRASQRMSSVGANFLCLGMALCLRQATRIPLNGTWLFTPVSKMATVKSELIERFTSEKPVHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLKGETMDLQHGSPFTKMPNIVCSKDYFVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSPHCKLIIVSNPVDILTYVAWKLSAFPKNRIIGSGCNLDTARFRFLIGQKLGIHSESCHGWILGEHGDSSVPVWSGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWAIGLSVADLTESILKNLRRIHPVSTITKGLYGIDEEVFLSIPCILGENGITNLIKIKLTPEEEAHLKKSAKTLWEIQNKLKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LDHAL6B lactate dehydrogenase A-like 6B [ Homo sapiens (human) ] |
Official Symbol | LDHAL6B |
Synonyms | LDHAL6B; lactate dehydrogenase A-like 6B; lactate dehydrogenase A like 6, LDHAL6; L-lactate dehydrogenase A-like 6B; LDH6B; LDHL; lactate dehydrogenase A-like 6; LDHAL6; |
Gene ID | 92483 |
mRNA Refseq | NM_033195 |
Protein Refseq | NP_149972 |
UniProt ID | Q9BYZ2 |
◆ Recombinant Proteins | ||
LDHAL6B-396C | Recombinant Cynomolgus Monkey LDHAL6B Protein, His (Fc)-Avi-tagged | +Inquiry |
LDHAL6B-2953H | Recombinant Human LDHAL6B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ldhal6b-302M | Recombinant Mouse Ldhal6b Protein, MYC/DDK-tagged | +Inquiry |
LDHAL6B-2487R | Recombinant Rhesus monkey LDHAL6B Protein, His-tagged | +Inquiry |
LDHAL6B-535H | Recombinant Human LDHAL6B, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHAL6B-4789HCL | Recombinant Human LDHAL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDHAL6B Products
Required fields are marked with *
My Review for All LDHAL6B Products
Required fields are marked with *
0
Inquiry Basket