Recombinant Human LDHC protein, His-tagged
| Cat.No. : | LDHC-2237H |
| Product Overview : | Recombinant Human LDHC protein(P07864)(2-332aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 2-332aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 38.2 kDa |
| AA Sequence : | STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | LDHC lactate dehydrogenase C [ Homo sapiens ] |
| Official Symbol | LDHC |
| Synonyms | LDHC; lactate dehydrogenase C; L-lactate dehydrogenase C chain; cancer/testis antigen 32; CT32; LDH-C; LDH-X; LDH testis subunit; lactate dehydrogenase C4; lactate dehydrogenase c variant 1; lactate dehydrogenase c variant 3; lactate dehydrogenase c variant 4; LDH3; LDHX; MGC111073; |
| Gene ID | 3948 |
| mRNA Refseq | NM_002301 |
| Protein Refseq | NP_002292 |
| MIM | 150150 |
| UniProt ID | P07864 |
| ◆ Recombinant Proteins | ||
| Ldhc-1307M | Recombinant Mouse Ldhc Protein, MYC/DDK-tagged | +Inquiry |
| LDHC-5022M | Recombinant Mouse LDHC Protein, His (Fc)-Avi-tagged | +Inquiry |
| LDHC-3159H | Recombinant Human LDHC protein, His-SUMO-tagged | +Inquiry |
| LDHC-295H | Recombinant Human LDHC Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LDHC-259H | Recombinant Human LDHC, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| LDH3-223H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
| LDH3-222H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
| LDH3-21H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
| LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
| LDHC-28045TH | Native Human LDHC | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LDHC-4786HCL | Recombinant Human LDHC 293 Cell Lysate | +Inquiry |
| LDHC-4787HCL | Recombinant Human LDHC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDHC Products
Required fields are marked with *
My Review for All LDHC Products
Required fields are marked with *
