Recombinant Human LECT1 protein, His-SUMO-tagged
| Cat.No. : | LECT1-3160H | 
| Product Overview : | Recombinant Human LECT1 protein(O75829)(215-334aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&SUMO | 
| Protein Length : | 215-334aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 29.8 kDa | 
| AA Sequence : | EVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | LECT1 leukocyte cell derived chemotaxin 1 [ Homo sapiens ] | 
| Official Symbol | LECT1 | 
| Synonyms | LECT1; leukocyte cell derived chemotaxin 1; multiple myeloma tumor suppressor 1 , MYETS1; leukocyte cell-derived chemotaxin 1; CHM I; CHM1; chondromodulin; chondromodulin I; chondromodulin-1; chondromodulin-I; BRICHOS domain containing 3; multiple myeloma tumor suppressor 1; CHM-I; BRICD3; MYETS1; | 
| Gene ID | 11061 | 
| mRNA Refseq | NM_001011705 | 
| Protein Refseq | NP_001011705 | 
| MIM | 605147 | 
| UniProt ID | O75829 | 
| ◆ Recombinant Proteins | ||
| LECT1-5030M | Recombinant Mouse LECT1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| LECT1-3028R | Recombinant Rat LECT1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| LECT1-6373C | Recombinant Chicken LECT1 | +Inquiry | 
| LECT1-3372R | Recombinant Rat LECT1 Protein | +Inquiry | 
| LECT1-5027H | Recombinant Human LECT1, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| LECT1-4780HCL | Recombinant Human LECT1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LECT1 Products
Required fields are marked with *
My Review for All LECT1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            