Recombinant Human LECT1 protein, His-SUMO-tagged
Cat.No. : | LECT1-3160H |
Product Overview : | Recombinant Human LECT1 protein(O75829)(215-334aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 215-334aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.8 kDa |
AA Sequence : | EVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | LECT1 leukocyte cell derived chemotaxin 1 [ Homo sapiens ] |
Official Symbol | LECT1 |
Synonyms | LECT1; leukocyte cell derived chemotaxin 1; multiple myeloma tumor suppressor 1 , MYETS1; leukocyte cell-derived chemotaxin 1; CHM I; CHM1; chondromodulin; chondromodulin I; chondromodulin-1; chondromodulin-I; BRICHOS domain containing 3; multiple myeloma tumor suppressor 1; CHM-I; BRICD3; MYETS1; |
Gene ID | 11061 |
mRNA Refseq | NM_001011705 |
Protein Refseq | NP_001011705 |
MIM | 605147 |
UniProt ID | O75829 |
◆ Recombinant Proteins | ||
LECT1-29939TH | Recombinant Human LECT1 | +Inquiry |
LECT1-5027H | Recombinant Human LECT1, His-tagged | +Inquiry |
LECT1-6748Z | Recombinant Zebrafish LECT1 | +Inquiry |
LECT1-426H | Recombinant Human leukocyte cell derived chemotaxin 1, His-tagged | +Inquiry |
LECT1-3160H | Recombinant Human LECT1 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LECT1-4780HCL | Recombinant Human LECT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LECT1 Products
Required fields are marked with *
My Review for All LECT1 Products
Required fields are marked with *