Recombinant Human LECT1 protein, His-SUMO-tagged

Cat.No. : LECT1-3160H
Product Overview : Recombinant Human LECT1 protein(O75829)(215-334aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 215-334aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 29.8 kDa
AA Sequence : EVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name LECT1 leukocyte cell derived chemotaxin 1 [ Homo sapiens ]
Official Symbol LECT1
Synonyms LECT1; leukocyte cell derived chemotaxin 1; multiple myeloma tumor suppressor 1 , MYETS1; leukocyte cell-derived chemotaxin 1; CHM I; CHM1; chondromodulin; chondromodulin I; chondromodulin-1; chondromodulin-I; BRICHOS domain containing 3; multiple myeloma tumor suppressor 1; CHM-I; BRICD3; MYETS1;
Gene ID 11061
mRNA Refseq NM_001011705
Protein Refseq NP_001011705
MIM 605147
UniProt ID O75829

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LECT1 Products

Required fields are marked with *

My Review for All LECT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon