Recombinant Human LEFTY1 Protein, Fc-tagged

Cat.No. : LEFTY1-003H
Product Overview : Recombinant Human LEFTY1 Protein with Fc tag was expressed in HEK293.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in left-right asymmetry determination of organ systems during development. This gene is closely linked to both a related family member and a related pseudogene.
Molecular Mass : 59 kDa
AA Sequence : RFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQPDDDDKEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : < 1 EU/μg by LAL
Purity : > 70 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.34 mg/mL
Storage Buffer : PBS, pH 7.4
Gene Name LEFTY1 left-right determination factor 1 [ Homo sapiens (human) ]
Official Symbol LEFTY1
Synonyms LEFTY1; left-right determination factor 1; LEFTB; LEFTYB; left-right determination factor 1; left-right determination factor B; protein lefty-1; protein lefty-B
Gene ID 10637
mRNA Refseq NM_020997
Protein Refseq NP_066277
MIM 603037
UniProt ID O75610

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LEFTY1 Products

Required fields are marked with *

My Review for All LEFTY1 Products

Required fields are marked with *

0
cart-icon
0
compare icon