Recombinant Human LEFTY1 Protein, Fc-tagged
| Cat.No. : | LEFTY1-003H |
| Product Overview : | Recombinant Human LEFTY1 Protein with Fc tag was expressed in HEK293. |
| Availability | January 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in left-right asymmetry determination of organ systems during development. This gene is closely linked to both a related family member and a related pseudogene. |
| Molecular Mass : | 59 kDa |
| AA Sequence : | RFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQPDDDDKEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 70 % by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.34 mg/mL |
| Storage Buffer : | PBS, pH 7.4 |
| Gene Name | LEFTY1 left-right determination factor 1 [ Homo sapiens (human) ] |
| Official Symbol | LEFTY1 |
| Synonyms | LEFTY1; left-right determination factor 1; LEFTB; LEFTYB; left-right determination factor 1; left-right determination factor B; protein lefty-1; protein lefty-B |
| Gene ID | 10637 |
| mRNA Refseq | NM_020997 |
| Protein Refseq | NP_066277 |
| MIM | 603037 |
| UniProt ID | O75610 |
| ◆ Recombinant Proteins | ||
| LEFTY1-27R | Recombinant Rat LEFTY1, His-tagged | +Inquiry |
| Lefty1-629M | Active Recombinant Mouse Lefty1 | +Inquiry |
| Lefty1-579M | Active Recombinant Mouse Left Right Determination Factor 1 | +Inquiry |
| Lefty1-1765M | Recombinant Mouse Left Right Determination Factor 1 | +Inquiry |
| LEFTY1-17H | Recombinant Human LEFTY1 Protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LEFTY1-980HCL | Recombinant Human LEFTY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEFTY1 Products
Required fields are marked with *
My Review for All LEFTY1 Products
Required fields are marked with *
