Recombinant Human LEFTY1 Protein, Fc-tagged
| Cat.No. : | LEFTY1-17H |
| Product Overview : | Recombinant Human LEFTY2 Protein, fused to Fc-tag, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in left-right asymmetry determination of organ systems during development. This gene is closely linked to both a related family member and a related pseudogene. |
| Form : | PBS, pH 7.4. |
| Molecular Mass : | 59 kDa |
| AA Sequence : | RFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQPDDDDKEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <1EU/ug by LAL |
| Purity : | >70% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.34 mg/ml |
| Gene Name | LEFTY1 left-right determination factor 1 [ Homo sapiens (human) ] |
| Official Symbol | LEFTY1 |
| Synonyms | LEFTB; LEFTYB |
| Gene ID | 10637 |
| mRNA Refseq | NM_020997.4 |
| Protein Refseq | NP_066277.1 |
| MIM | 603037 |
| UniProt ID | O75610 |
| ◆ Recombinant Proteins | ||
| LEFTY1-17H | Recombinant Human LEFTY1 Protein, Fc-tagged | +Inquiry |
| LEFTY1-5033M | Recombinant Mouse LEFTY1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Lefty1-370M | Recombinant Mouse Lefty1 Protein, His/GST-tagged | +Inquiry |
| LEFTY1-3923H | Recombinant Human LEFTY1 Protein (Phe78-Pro361), His tagged | +Inquiry |
| Lefty1-371R | Recombinant Rat Lefty1 Protein, His/GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LEFTY1-980HCL | Recombinant Human LEFTY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEFTY1 Products
Required fields are marked with *
My Review for All LEFTY1 Products
Required fields are marked with *
