Recombinant Human LEFTY1 Protein, Fc-tagged
Cat.No. : | LEFTY1-17H |
Product Overview : | Recombinant Human LEFTY2 Protein, fused to Fc-tag, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in left-right asymmetry determination of organ systems during development. This gene is closely linked to both a related family member and a related pseudogene. |
Form : | PBS, pH 7.4. |
Molecular Mass : | 59 kDa |
AA Sequence : | RFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQPDDDDKEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <1EU/ug by LAL |
Purity : | >70% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.34 mg/ml |
Gene Name | LEFTY1 left-right determination factor 1 [ Homo sapiens (human) ] |
Official Symbol | LEFTY1 |
Synonyms | LEFTB; LEFTYB |
Gene ID | 10637 |
mRNA Refseq | NM_020997.4 |
Protein Refseq | NP_066277.1 |
MIM | 603037 |
UniProt ID | O75610 |
◆ Recombinant Proteins | ||
Lefty1-370M | Recombinant Mouse Lefty1 Protein, His/GST-tagged | +Inquiry |
LEFTY-001C | Recombinant Cynomolgus Monkey LEFTY1 Protein, His-Tagged | +Inquiry |
LEFTY1-367H | Recombinant Human LEFTY1 Protein, His-tagged | +Inquiry |
LEFTY1-9036M | Recombinant Mouse LEFTY1 Protein | +Inquiry |
LEFTY1-27R | Recombinant Rat LEFTY1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEFTY1-980HCL | Recombinant Human LEFTY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEFTY1 Products
Required fields are marked with *
My Review for All LEFTY1 Products
Required fields are marked with *