Recombinant Human LEFTY2 protein, His&Myc-tagged
| Cat.No. : | LEFTY2-3161H |
| Product Overview : | Recombinant Human LEFTY2 protein(O00292)(77-366aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 77-366aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.8 kDa |
| AA Sequence : | RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | LEFTY2 left-right determination factor 2 [ Homo sapiens ] |
| Official Symbol | LEFTY2 |
| Synonyms | LEFTY2; left-right determination factor 2; EBAF, endometrial bleeding associated factor (left right determination, factor A; transforming growth factor beta superfamily) , TGFB4; LEFTA; LEFTYA; transforming growth factor; beta 4 (endometrial bleeding associated factor; LEFTY A); TGF-beta-4; protein lefty-2; protein lefty-A; left-right determination factor A; transforming growth factor beta-4; endometrial bleeding-associated factor; EBAF; TGFB4; MGC46222; |
| Gene ID | 7044 |
| mRNA Refseq | NM_003240 |
| Protein Refseq | NP_003231 |
| UniProt ID | O00292 |
| ◆ Recombinant Proteins | ||
| LEFTY2-7972H | Recombinant Human LEFTY2 protein, His-tagged | +Inquiry |
| LEFTY2-5034M | Recombinant Mouse LEFTY2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LEFTY2-002H | Recombinant Human LEFTY2 Protein, C-His tagged | +Inquiry |
| LEFTY2-501H | Recombinant Human LEFTY2 protein, His-tagged | +Inquiry |
| LEFTY2-9037M | Recombinant Mouse LEFTY2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LEFTY2-2779HCL | Recombinant Human LEFTY2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEFTY2 Products
Required fields are marked with *
My Review for All LEFTY2 Products
Required fields are marked with *



