Recombinant Human LEP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LEP-3523H |
Product Overview : | LEP MS Standard C13 and N15-labeled recombinant protein (NP_000221) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development. |
Molecular Mass : | 18.6 kDa |
AA Sequence : | MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LEP leptin [ Homo sapiens (human) ] |
Official Symbol | LEP |
Synonyms | LEP; leptin; leptin (murine obesity homolog), leptin (obesity homolog, mouse), OB, OBS; obese protein; obesity factor; obese, mouse, homolog of; leptin (murine obesity homolog); leptin (obesity homolog, mouse); OB; OBS; FLJ94114; |
Gene ID | 3952 |
mRNA Refseq | NM_000230 |
Protein Refseq | NP_000221 |
MIM | 164160 |
UniProt ID | P41159 |
◆ Recombinant Proteins | ||
LEP-0610H | Recombinant Human LEP Protein (Val22-Cys167), Tag Free | +Inquiry |
LEP-202H | Recombinant Human LEP, None tagged | +Inquiry |
LEP-12H | Recombinant Human Leptin, His Tag | +Inquiry |
LEP-674C | Recombinant Chicken LEP protein, His & S-tagged | +Inquiry |
LEP-2317R | Recombinant Rhesus Macaque LEP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
LEP-27641TH | Native Human LEP | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEP-4773HCL | Recombinant Human LEP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LEP Products
Required fields are marked with *
My Review for All LEP Products
Required fields are marked with *
0
Inquiry Basket