Recombinant Human LFNG

Cat.No. : LFNG-29854TH
Product Overview : Recombinant full length Human Lunatic Fringe, isoform 2 with N terminal proprietary tag; Predicted MW 53.24 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 250 amino acids
Description : This gene is a member of the fringe gene family which also includes radical and manic fringe genes. They all encode evolutionarily conserved glycosyltransferases that act in the Notch signaling pathway to define boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. This gene product is predicted to be a single-pass type II Golgi membrane protein but it may also be secreted and proteolytically processed like the related proteins in mouse and Drosophila (PMID: 9187150). Mutations in this gene have been associated with autosomal recessive spondylocostal dysostosis 3. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 53.240kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNCS AAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRA LLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVH FWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPD DCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQ VTLSYGMFENKRNAVHVKGPFSVEADPSRFRSIHCHLYPD TPWCPRTAIF
Sequence Similarities : Belongs to the glycosyltransferase 31 family.
Gene Name LFNG LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase [ Homo sapiens ]
Official Symbol LFNG
Synonyms LFNG; LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase; lunatic fringe (Drosophila) homolog , lunatic fringe homolog (Drosophila); beta-1,3-N-acetylglucosaminyltransferase lunatic fringe; SCDO3;
Gene ID 3955
mRNA Refseq NM_001040167
Protein Refseq NP_001035257
MIM 602576
Uniprot ID Q8NES3
Chromosome Location 7p22.3
Pathway Delta-Notch Signaling Pathway, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch signaling pathway, conserved biosystem; Other types of O-glycan biosynthesis, organism-specific biosystem; Other types of O-glycan biosynthesis, conserved biosystem;
Function O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity; molecular_function; transferase activity, transferring glycosyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LFNG Products

Required fields are marked with *

My Review for All LFNG Products

Required fields are marked with *

0
cart-icon
0
compare icon