Recombinant Human LGALSL Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LGALSL-475H
• Product Overview: HSPC159 MS Standard C13 and N15-labeled recombinant protein (NP_054900) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Does not bind lactose, and may not bind carbohydrates.
• Molecular Mass: 19 kDa
• AA Sequence: MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LGALSL galectin like [ Homo sapiens (human) ]
• Official Symbol: LGALSL
• Synonyms: lectin, galactoside-binding-like; 25012; Ensembl:ENSG00000119862; MGC33751, MGC71953; galectin-related protein;lectin galactoside-binding-like protein; GRP; HSPC159
• Gene ID: 29094
• mRNA Refseq: NM_014181
• Protein Refseq: NP_054900
• MIM: 617902
• UniProt ID: Q3ZCW2