Recombinant Human LGALSL Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LGALSL-475H
Product Overview : HSPC159 MS Standard C13 and N15-labeled recombinant protein (NP_054900) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Does not bind lactose, and may not bind carbohydrates.
Molecular Mass : 19 kDa
AA Sequence : MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LGALSL galectin like [ Homo sapiens (human) ]
Official Symbol LGALSL
Synonyms lectin, galactoside-binding-like; 25012; Ensembl:ENSG00000119862; MGC33751, MGC71953; galectin-related protein;lectin galactoside-binding-like protein; GRP; HSPC159
Gene ID 29094
mRNA Refseq NM_014181
Protein Refseq NP_054900
MIM 617902
UniProt ID Q3ZCW2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LGALSL Products

Required fields are marked with *

My Review for All LGALSL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon