Recombinant Human LGALSL Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LGALSL-475H |
Product Overview : | HSPC159 MS Standard C13 and N15-labeled recombinant protein (NP_054900) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Does not bind lactose, and may not bind carbohydrates. |
Molecular Mass : | 19 kDa |
AA Sequence : | MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LGALSL galectin like [ Homo sapiens (human) ] |
Official Symbol | LGALSL |
Synonyms | lectin, galactoside-binding-like; 25012; Ensembl:ENSG00000119862; MGC33751, MGC71953; galectin-related protein;lectin galactoside-binding-like protein; GRP; HSPC159 |
Gene ID | 29094 |
mRNA Refseq | NM_014181 |
Protein Refseq | NP_054900 |
MIM | 617902 |
UniProt ID | Q3ZCW2 |
◆ Recombinant Proteins | ||
LGALSL-7537H | Recombinant Human LGALSL, His-tagged | +Inquiry |
LGALSL-475H | Recombinant Human LGALSL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LGALSL-5655HF | Recombinant Full Length Human LGALSL Protein, GST-tagged | +Inquiry |
LGALSL-5268H | Recombinant Human LGALSL Protein, GST-tagged | +Inquiry |
LGALSL-126H | Recombinant Human LGALSL, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALSL-824HCL | Recombinant Human LGALSL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALSL Products
Required fields are marked with *
My Review for All LGALSL Products
Required fields are marked with *
0
Inquiry Basket