Recombinant Human LGALSL Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LGALSL-475H |
| Product Overview : | HSPC159 MS Standard C13 and N15-labeled recombinant protein (NP_054900) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Does not bind lactose, and may not bind carbohydrates. |
| Molecular Mass : | 19 kDa |
| AA Sequence : | MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LGALSL galectin like [ Homo sapiens (human) ] |
| Official Symbol | LGALSL |
| Synonyms | lectin, galactoside-binding-like; 25012; Ensembl:ENSG00000119862; MGC33751, MGC71953; galectin-related protein;lectin galactoside-binding-like protein; GRP; HSPC159 |
| Gene ID | 29094 |
| mRNA Refseq | NM_014181 |
| Protein Refseq | NP_054900 |
| MIM | 617902 |
| UniProt ID | Q3ZCW2 |
| ◆ Recombinant Proteins | ||
| LGALSL-1834C | Recombinant Chicken LGALSL | +Inquiry |
| LGALSL-126H | Recombinant Human LGALSL, His-tagged | +Inquiry |
| LGALSL-5268H | Recombinant Human LGALSL Protein, GST-tagged | +Inquiry |
| LGALSL-3352H | Recombinant Human LGALSL Protein, His (Fc)-Avi-tagged | +Inquiry |
| Lgalsl-3777M | Recombinant Mouse Lgalsl Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LGALSL-824HCL | Recombinant Human LGALSL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALSL Products
Required fields are marked with *
My Review for All LGALSL Products
Required fields are marked with *




