Recombinant Human LIF protein, GST-tagged
Cat.No. : | LIF-301508H |
Product Overview : | Recombinant Human LIF (27-202 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ile27-Phe202 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | ITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | LIF leukemia inhibitory factor [ Homo sapiens ] |
Official Symbol | LIF |
Synonyms | LIF; leukemia inhibitory factor; CDF; cholinergic differentiation factor; DIA; differentiation inhibitory activity; differentiation inducing factor; hepatocyte stimulating factor III; HILDA; human interleukin in DA cells; D factor; melanoma-derived LPL inhibitor; differentiation-inducing factor; hepatocyte-stimulating factor III; differentiation-stimulating factor; MLPLI; |
Gene ID | 3976 |
mRNA Refseq | NM_001257135 |
Protein Refseq | NP_001244064 |
MIM | 159540 |
UniProt ID | P15018 |
◆ Recombinant Proteins | ||
LIF-634H | Active Recombinant Human LIF, His-tagged, Biotinylated | +Inquiry |
LIF-6754H | Recombinant Human LIF protein | +Inquiry |
LIF-2753C | Recombinant Cattle LIF Protein, His-tagged | +Inquiry |
Lif-10M | Active Recombinant mouse LIF | +Inquiry |
LIF-4656H | Recombinant Human LIF protein, Trx-His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
LIF-1071HCL | Recombinant Human LIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIF Products
Required fields are marked with *
My Review for All LIF Products
Required fields are marked with *