Recombinant Human LIG1 protein, His-tagged
| Cat.No. : | LIG1-3849H |
| Product Overview : | Recombinant Human LIG1 protein(670-919 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 670-919 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPEDTY |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | LIG1 ligase I, DNA, ATP-dependent [ Homo sapiens ] |
| Official Symbol | LIG1 |
| Synonyms | LIG1; ligase I, DNA, ATP-dependent; DNA ligase 1; polydeoxyribonucleotide synthase [ATP] 1; MGC117397; MGC130025; |
| Gene ID | 3978 |
| mRNA Refseq | NM_000234 |
| Protein Refseq | NP_000225 |
| MIM | 126391 |
| UniProt ID | P18858 |
| ◆ Recombinant Proteins | ||
| LIG1-26930TH | Recombinant Human LIG1, His-tagged | +Inquiry |
| LIG1-4446H | Recombinant Human LIG1 Protein (Gly484-Ile663), N-His tagged | +Inquiry |
| LIG1-196HFL | Active Recombinant Full Length Human LIG1 Protein, C-Flag-tagged | +Inquiry |
| LIG1-3175H | Recombinant Human LIG1 protein, GST-tagged | +Inquiry |
| LIG1-1519H | Recombinant Human LIG1 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LIG1-985HCL | Recombinant Human LIG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIG1 Products
Required fields are marked with *
My Review for All LIG1 Products
Required fields are marked with *
