Recombinant Human LIG1 protein, His-tagged
Cat.No. : | LIG1-3849H |
Product Overview : | Recombinant Human LIG1 protein(670-919 aa), fused to His tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 670-919 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPEDTY |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LIG1 ligase I, DNA, ATP-dependent [ Homo sapiens ] |
Official Symbol | LIG1 |
Synonyms | LIG1; ligase I, DNA, ATP-dependent; DNA ligase 1; polydeoxyribonucleotide synthase [ATP] 1; MGC117397; MGC130025; |
Gene ID | 3978 |
mRNA Refseq | NM_000234 |
Protein Refseq | NP_000225 |
MIM | 126391 |
UniProt ID | P18858 |
◆ Recombinant Proteins | ||
LIG1-1519H | Recombinant Human LIG1 protein | +Inquiry |
LIG1-1293H | Recombinant Human LIG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lig1-6751R | Recombinant Rat Lig1 protein, His & T7-tagged | +Inquiry |
LIG1-3175H | Recombinant Human LIG1 protein, GST-tagged | +Inquiry |
Lig1-1318M | Recombinant Mouse Lig1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIG1-985HCL | Recombinant Human LIG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIG1 Products
Required fields are marked with *
My Review for All LIG1 Products
Required fields are marked with *