Recombinant Human LIG3 protein, GST-tagged
| Cat.No. : | LIG3-3683H |
| Product Overview : | Recombinant Human LIG3 protein(254-390 aa), fused to GST tag, was expressed in E. coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 254-390 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | LIG3 ligase III, DNA, ATP-dependent [ Homo sapiens ] |
| Official Symbol | LIG3 |
| Synonyms | LIG3; ligase III, DNA, ATP-dependent; LIG2, ligase II, DNA, ATP dependent; DNA ligase 3; ligase II, DNA, ATP-dependent; polydeoxyribonucleotide synthase [ATP] 3; LIG2; |
| Gene ID | 3980 |
| mRNA Refseq | NM_002311 |
| Protein Refseq | NP_002302 |
| MIM | 600940 |
| UniProt ID | P49916 |
| ◆ Recombinant Proteins | ||
| LIG3-599HFL | Recombinant Full Length Human LIG3 Protein, C-Flag-tagged | +Inquiry |
| LIG3-1363C | Recombinant Chicken LIG3 | +Inquiry |
| LIG3-1520H | Recombinant Human LIG3 Protein, His-tagged | +Inquiry |
| LIG3-3281Z | Recombinant Zebrafish LIG3 | +Inquiry |
| LIG3-2332R | Recombinant Rhesus Macaque LIG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIG3 Products
Required fields are marked with *
My Review for All LIG3 Products
Required fields are marked with *



