Recombinant Human LILRA3 Protein, HIS-tagged
Cat.No. : | LILRA3-148H |
Product Overview : | Recombinant Human LILRA3 fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4 |
Molecular Mass : | 46.6kD |
AA Sequence : | THVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGEVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | LILRA3 leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 [ Homo sapiens ] |
Official Symbol | LILRA3 |
Synonyms | LILRA3; leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3; leukocyte immunoglobulin-like receptor subfamily A member 3; CD85e; HM31; HM43; ILT6; LIR 4; LIR4; ILT-6; immunoglobulin-like transcript 6; CD85 antigen-like family member E; leucocyte immunoglobulin-like receptor; monocyte inhibitory receptor HM43/HM31; leukocyte immunoglobulin-like receptor 4; leukocyte immunoglobulin-like receptor A3; e3; CD85E; LIR-4; |
Gene ID | 11026 |
mRNA Refseq | NM_001172654 |
Protein Refseq | NP_001166125 |
MIM | 604818 |
UniProt ID | Q8N6C8 |
◆ Recombinant Proteins | ||
LILRA3-2335R | Recombinant Rhesus Macaque LILRA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LILRA3-311HB | Recombinant Human LILRA3 protein, His-tagged, Biotinylated | +Inquiry |
LILRA3-1820R | Recombinant Rhesus Monkey LILRA3 Protein, hIgG4-tagged | +Inquiry |
LILRA3-3956H | Recombinant Human LILRA3 Protein (Met1-Glu439), C-His tagged | +Inquiry |
LILRA3-6698H | Recombinant Human LILRA3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRA3-1349HCL | Recombinant Human LILRA3 cell lysate | +Inquiry |
LILRA3-976HCL | Recombinant Human LILRA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRA3 Products
Required fields are marked with *
My Review for All LILRA3 Products
Required fields are marked with *