Recombinant Human LILRA5 Protein (42-268 aa), His-tagged
| Cat.No. : | LILRA5-1444H |
| Product Overview : | Recombinant Human LILRA5 Protein (42-268 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 42-268 aa |
| Description : | May play a role in triggering innate immune responses. Does not se to play a role for any class I MHC antigen recognition. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 27.2 kDa |
| AA Sequence : | GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 [ Homo sapiens ] |
| Official Symbol | LILRA5 |
| Synonyms | LILRA5; LILRB7; CD85; CD85f; ILT11; LIR9; CD85F; LIR-9; ILT-11; |
| Gene ID | 353514 |
| mRNA Refseq | NM_021250 |
| Protein Refseq | NP_067073 |
| MIM | 606047 |
| UniProt ID | A6NI73 |
| ◆ Recombinant Proteins | ||
| LILRA5-5033H | Recombinant Human LILRA5 protein, His-tagged | +Inquiry |
| LILRA5-482H | Recombinant Human LILRA5 Protein, His-tagged | +Inquiry |
| LILRA5-761H | Active Recombinant Human LILRA5 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
| LILRA5-3176H | Recombinant Human LILRA5 protein, His-tagged | +Inquiry |
| LILRA5-759H | Recombinant Human LILRA5 Protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LILRA5-1359RCL | Recombinant Rat LILRA5 cell lysate | +Inquiry |
| LILRA5-1384RCL | Recombinant Rat LILRA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRA5 Products
Required fields are marked with *
My Review for All LILRA5 Products
Required fields are marked with *
