Recombinant Human LILRA5 Protein (42-268 aa), His-tagged
Cat.No. : | LILRA5-1444H |
Product Overview : | Recombinant Human LILRA5 Protein (42-268 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 42-268 aa |
Description : | May play a role in triggering innate immune responses. Does not se to play a role for any class I MHC antigen recognition. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 27.2 kDa |
AA Sequence : | GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 [ Homo sapiens ] |
Official Symbol | LILRA5 |
Synonyms | LILRA5; LILRB7; CD85; CD85f; ILT11; LIR9; CD85F; LIR-9; ILT-11; |
Gene ID | 353514 |
mRNA Refseq | NM_021250 |
Protein Refseq | NP_067073 |
MIM | 606047 |
UniProt ID | A6NI73 |
◆ Recombinant Proteins | ||
LILRA5-760H | Recombinant Human LILRA5 Protein, His-tagged | +Inquiry |
Lilra5-8778R | Recombinant Rat Lilra5 protein(Met1-Asn248), hFc-tagged | +Inquiry |
LILRA5-4262H | Recombinant Human LILRA5 Protein (Met1-Arg268), C-His tagged | +Inquiry |
LILRA5-1444H | Recombinant Human LILRA5 Protein (42-268 aa), His-tagged | +Inquiry |
Lilra5-264H | Active Recombinant Mouse Lilra5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRA5-1384RCL | Recombinant Rat LILRA5 cell lysate | +Inquiry |
LILRA5-1359RCL | Recombinant Rat LILRA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LILRA5 Products
Required fields are marked with *
My Review for All LILRA5 Products
Required fields are marked with *
0
Inquiry Basket