Recombinant Human LILRA5 Protein (42-268 aa), His-tagged

• Cat.No.: LILRA5-1444H
• Product Overview: Recombinant Human LILRA5 Protein (42-268 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 42-268 aa
• Description: May play a role in triggering innate immune responses. Does not se to play a role for any class I MHC antigen recognition.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.2 kDa
• AA Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 [ Homo sapiens ]
• Official Symbol: LILRA5
• Synonyms: LILRA5; LILRB7; CD85; CD85f; ILT11; LIR9; CD85F; LIR-9; ILT-11
• Gene ID: 353514
• mRNA Refseq: NM_021250
• Protein Refseq: NP_067073
• MIM: 606047
• UniProt ID: A6NI73