Recombinant Human LILRA5 Protein (42-268 aa), His-tagged

Cat.No. : LILRA5-1444H
Product Overview : Recombinant Human LILRA5 Protein (42-268 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 42-268 aa
Description : May play a role in triggering innate immune responses. Does not se to play a role for any class I MHC antigen recognition.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 27.2 kDa
AA Sequence : GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 [ Homo sapiens ]
Official Symbol LILRA5
Synonyms LILRA5; LILRB7; CD85; CD85f; ILT11; LIR9; CD85F; LIR-9; ILT-11;
Gene ID 353514
mRNA Refseq NM_021250
Protein Refseq NP_067073
MIM 606047
UniProt ID A6NI73

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LILRA5 Products

Required fields are marked with *

My Review for All LILRA5 Products

Required fields are marked with *

0
cart-icon
0
compare icon