Recombinant Human LIMD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LIMD2-4772H
• Product Overview: LIMD2 MS Standard C13 and N15-labeled recombinant protein (NP_085053) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: LIMD2 (LIM Domain Containing 2) is a Protein Coding gene. Diseases associated with LIMD2 include Fraser Syndrome 1. An important paralog of this gene is TES.
• Molecular Mass: 14.1 kDa
• AA Sequence: MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKEVDPGTKTATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LIMD2 LIM domain containing 2 [ Homo sapiens (human) ]
• Official Symbol: LIMD2
• Synonyms: LIMD2; LIM domain containing 2; LIM domain-containing protein 2; MGC10986
• Gene ID: 80774
• mRNA Refseq: NM_030576
• Protein Refseq: NP_085053
• UniProt ID: Q9BT23