Recombinant Human LIMD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LIMD2-4772H |
Product Overview : | LIMD2 MS Standard C13 and N15-labeled recombinant protein (NP_085053) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | LIMD2 (LIM Domain Containing 2) is a Protein Coding gene. Diseases associated with LIMD2 include Fraser Syndrome 1. An important paralog of this gene is TES. |
Molecular Mass : | 14.1 kDa |
AA Sequence : | MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKEVDPGTKTATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LIMD2 LIM domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | LIMD2 |
Synonyms | LIMD2; LIM domain containing 2; LIM domain-containing protein 2; MGC10986; |
Gene ID | 80774 |
mRNA Refseq | NM_030576 |
Protein Refseq | NP_085053 |
UniProt ID | Q9BT23 |
◆ Recombinant Proteins | ||
LIMD2-3411R | Recombinant Rat LIMD2 Protein | +Inquiry |
LIMD2-4772H | Recombinant Human LIMD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LIMD2-2339R | Recombinant Rhesus Macaque LIMD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LIMD2-2519R | Recombinant Rhesus monkey LIMD2 Protein, His-tagged | +Inquiry |
LIMD2-15878H | Recombinant Human LIMD2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIMD2-4741HCL | Recombinant Human LIMD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIMD2 Products
Required fields are marked with *
My Review for All LIMD2 Products
Required fields are marked with *